[2013|2011]

31/12/2012

FJ600374; SV 1; linear; mRNA; STD; PLN; 1019 BP.
FJ600374;
Brassica rapa subsp. chinensis TuMV resistance protein-like protein (BcTuR1) mRNA, complete cds.

FJ600375; SV 1; linear; mRNA; STD; PLN; 996 BP.
FJ600375;
Brassica rapa subsp. chinensis virus-resistance protein (BcTuRGA) mRNA, complete cds.

FJ600376; SV 1; linear; mRNA; STD; PLN; 650 BP.
FJ600376;
Brassica rapa subsp. chinensis resistance protein (BcTuRsO) mRNA, complete cds.


29/12/2012

JQ320085; SV 1; linear; mRNA; STD; PLN; 653 BP.
JQ320085;
Brassica napus COP9 signalosome complex subunit 8 (COP9) mRNA, complete cds.

JX901141; SV 1; linear; genomic DNA; STD; PLN; 4333 BP.
JX901141;
Brassica napus cultivar Ningyou7 FLC (FLC.A10) gene, complete cds.

JX901142; SV 1; linear; genomic DNA; STD; PLN; 6705 BP.
JX901142;
Brassica napus cultivar Tapidor MITE Tourist-like, complete sequence; and FLC (FLC.A10) gene, complete cds.


24/12/2012

KC020603; SV 1; linear; genomic DNA; STD; PLN; 2163 BP.
KC020603;
Brassica napus cultivar 417 eukaryotic translation initiation factor eIF4E.a gene, complete cds.

KC020604; SV 1; linear; genomic DNA; STD; PLN; 2164 BP.
KC020604;
Brassica napus cultivar Galaxy eukaryotic translation initiation factor eIF4E.a gene, complete cds.

KC020605; SV 1; linear; genomic DNA; STD; PLN; 2186 BP.
KC020605;
Brassica napus cultivar Japan8 eukaryotic translation initiation factor eIF4E.a gene, complete cds.

KC020606; SV 1; linear; genomic DNA; STD; PLN; 2025 BP.
KC020606;
Brassica napus cultivar 417 eukaryotic translation initiation factor eIF(iso)4E.a gene, complete cds.

KC020607; SV 1; linear; genomic DNA; STD; PLN; 2078 BP.
KC020607;
Brassica napus cultivar Galaxy eukaryotic translation initiation factor eIF(iso)4E.a gene, complete cds.

KC020608; SV 1; linear; genomic DNA; STD; PLN; 2079 BP.
KC020608;
Brassica napus cultivar Japan8 eukaryotic translation initiation factor eIF(iso)4E.a gene, complete cds.


15/12/2012

FJ965337; SV 1; linear; mRNA; STD; PLN; 387 BP.
FJ965337;
Brassica rapa subsp. pekinensis dormancy-associated protein 1 (DRM1) mRNA, complete cds.

FJ965338; SV 1; linear; mRNA; STD; PLN; 597 BP.
FJ965338;
Brassica rapa subsp. pekinensis auxin-repressed protein 1 (ARP1) mRNA, complete cds.

FJ969844; SV 1; linear; mRNA; STD; PLN; 491 BP.
FJ969844;
Brassica rapa subsp. pekinensis actin 1 (ACT1) mRNA, partial cds.


14/12/2012

JN656712; SV 1; linear; mRNA; STD; PLN; 642 BP.
JN656712;
Brassica oleracea var. capitata glutathione S-transferase (GSTO1) mRNA, complete cds.

JN993702; SV 1; linear; mRNA; STD; PLN; 558 BP.
JN993702;
Brassica oleracea var. capitata deoxycytidine deaminase mRNA, complete cds.


13/12/2012

JX870620; SV 1; linear; mRNA; STD; PLN; 1278 BP.
JX870620;
Brassica oleracea var. capitata ABA insensitve 5-like protein mRNA, complete cds.


06/12/2012

JF807893; SV 1; linear; genomic DNA; STD; PLN; 1470 BP.
JF807893;
Brassica napus cultivar Qingyou-12 acetyl CoA carboxylase carboxyltransferase beta subunit (accD) gene, complete cds; chloroplast.

JF807894; SV 1; linear; genomic DNA; STD; PLN; 1470 BP.
JF807894;
Brassica oleracea cultivar 2006 Holland-2 acetyl CoA carboxylase carboxyltransferase beta subunit (accD) gene, complete cds; chloroplast.

JF807895; SV 1; linear; genomic DNA; STD; PLN; 1470 BP.
JF807895;
Brassica napus cultivar H51 acetyl CoA carboxylase carboxyltransferase beta subunit (accD) gene, complete cds; chloroplast.

JF807896; SV 1; linear; genomic DNA; STD; PLN; 1464 BP.
JF807896;
Brassica napus cultivar Huayou-13 acetyl CoA carboxylase carboxyltransferase beta subunit (accD) gene, complete cds; chloroplast.

JF807897; SV 1; linear; genomic DNA; STD; PLN; 1464 BP.
JF807897;
Brassica rapa cultivar Xishui rape acetyl CoA carboxylase carboxyltransferase beta subunit (accD) gene, complete cds; chloroplast.

JF807898; SV 1; linear; genomic DNA; STD; PLN; 1464 BP.
JF807898;
Brassica napus cultivar Zhongyoudijie-1 acetyl CoA carboxylase carboxyltransferase beta subunit (accD) gene, complete cds; chloroplast.

JF807903; SV 1; linear; genomic DNA; STD; PLN; 1596 BP.
JF807903;
Brassica napus cultivar Nevin maturase K (matK) gene, complete cds; chloroplast.

JF807904; SV 1; linear; genomic DNA; STD; PLN; 1596 BP.
JF807904;
Brassica napus cultivar Samouran maturase K (matK) gene, complete cds; chloroplast.

JF807905; SV 1; linear; genomic DNA; STD; PLN; 1596 BP.
JF807905;
Brassica napus cultivar Start maturase K (matK) gene, complete cds; chloroplast.

JF807906; SV 1; linear; genomic DNA; STD; PLN; 1596 BP.
JF807906;
Brassica rapa cultivar 2006 Holland-2 maturase K (matK) gene, complete cds; chloroplast.

JF807907; SV 1; linear; genomic DNA; STD; PLN; 1733 BP.
JF807907;
Brassica napus cultivar Huayou-8 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, complete cds; chloroplast.

JF807908; SV 1; linear; genomic DNA; STD; PLN; 1733 BP.
JF807908;
Brassica napus cultivar Start ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, complete cds; chloroplast.

JN834015; SV 1; linear; genomic DNA; STD; PLN; 1406 BP.
JN834015;
Brassica napus cultivar Tapidor 4-hydroxyphenylpyruvate dioxygenase (BnaX.PDS1.b) gene, complete cds.

JN834016; SV 1; linear; genomic DNA; STD; PLN; 1430 BP.
JN834016;
Brassica napus cultivar Tapidor 4-hydroxyphenylpyruvate dioxygenase (BnaA.PDS1.c) gene, complete cds.

JN834017; SV 1; linear; genomic DNA; STD; PLN; 2809 BP.
JN834017;
Brassica napus cultivar Tapidor tocopherol cyclase (BnaX.VTE1.a) gene, complete cds. FT                   RFEFRDAPSYSEKNWGGGFPRKWFWVQCNVFERAKGEVALTAAGGLRQLPGLTETFENA

JN834018; SV 1; linear; genomic DNA; STD; PLN; 2870 BP.
JN834018;
Brassica napus cultivar Tapidor tocopherol cyclase (BnaX.VTE1.b) gene, complete cds. FT                   RFEFRDAPSYSEKNWGGGFPRKWFWVQCNVFEGAKGEIALTAAGGLRQLPGLTETFENA

JN834019; SV 1; linear; genomic DNA; STD; PLN; 2340 BP.
JN834019;
Brassica napus cultivar Tapidor homogentisate phytyltransferase (BnaA.VTE2.a) gene, complete cds.

JN834020; SV 1; linear; genomic DNA; STD; PLN; 2354 BP.
JN834020;
Brassica napus cultivar Tapidor homogentisate phytyltransferase (BnaX.VTE2.b) gene, complete cds.

JN834021; SV 1; linear; genomic DNA; STD; PLN; 1245 BP.
JN834021;
Brassica napus cultivar Tapidor chloroplast MPBQ/MSBQ methyltransferase (BnaX.VTE3.a) gene, complete cds; nuclear gene for chloroplast product.

JN834022; SV 1; linear; genomic DNA; STD; PLN; 1242 BP.
JN834022;
Brassica napus cultivar Tapidor chloroplast MPBQ/MSBQ methyltransferase (BnaX.VTE3.b) gene, complete cds; nuclear gene for chloroplast product.

JN834023; SV 1; linear; genomic DNA; STD; PLN; 2117 BP.
JN834023;
Brassica napus cultivar Tapidor gamma-tocopherol methyltransferase (BnaX.VTE4.b) gene, complete cds.

JN834024; SV 1; linear; genomic DNA; STD; PLN; 2078 BP.
JN834024;
Brassica napus cultivar Tapidor gamma-tocopherol methyltransferase (BnaX.VTE4.c) gene, complete cds.

JN834025; SV 1; linear; genomic DNA; STD; PLN; 2999 BP.
JN834025;
Brassica napus cultivar Tapidor phytol kinase (BnaC.VTE5) gene, complete cds.

JN834026; SV 1; linear; genomic DNA; STD; PLN; 1442 BP.
JN834026;
Brassica napus cultivar Tapidor 4-hydroxyphenylpyruvate dioxygenase (BnaX.PDS1.a) gene, complete cds.


03/12/2012

JX868512; SV 1; linear; genomic DNA; STD; PLN; 3585 BP.
JX868512;
Brassica napus brassinosteroid-insensitive 1 protein (BRI1) gene, complete cds.

JX868513; SV 1; linear; genomic DNA; STD; PLN; 3590 BP.
JX868513;
Brassica napus mutant brassinosteroid-insensitive 1 protein (BRI1) gene, partial cds.

JX871217; SV 1; linear; mRNA; STD; PLN; 3585 BP.
JX871217;
Brassica napus brassinosteroid-insensitive 1 protein (BRI1) mRNA, complete cds.

JX871218; SV 1; linear; mRNA; STD; PLN; 3590 BP.
JX871218;
Brassica napus mutant brassinosteroid-insensitive 1 protein (BRI1) mRNA, partial cds.


01/12/2012

GU219991; SV 1; linear; genomic DNA; STD; PLN; 3560 BP.
GU219991;
Brassica oleracea var. botrytis cultivar Stovepipe WD40 transcription regulator (TTG1) gene, complete cds.

JN872633; SV 1; linear; genomic DNA; STD; PLN; 2124 BP.
JN872633;
Brassica rapa subsp. campestris cultivar Taisankang leucine-rich repeat receptor-like kinase (LRK01) gene, complete cds.

JQ027695; SV 1; linear; mRNA; STD; PLN; 1806 BP.
JQ027695;
Brassica rapa subsp. pekinensis catalase 1 (Cat1) mRNA, complete cds.

JQ027696; SV 1; linear; mRNA; STD; PLN; 1715 BP.
JQ027696;
Brassica rapa subsp. pekinensis catalase 2 (Cat2) mRNA, complete cds.


26/11/2012

JX680469; SV 1; linear; mRNA; STD; PLN; 785 BP.
JX680469;
Brassica oleracea tetrapyrrole-binding protein (GUN4) mRNA, complete cds.

JX680470; SV 1; linear; mRNA; STD; PLN; 789 BP.
JX680470;
Brassica rapa subsp. campestris tetrapyrrole-binding protein (GUN4) mRNA, complete cds.


22/11/2012

JF957836; SV 1; linear; mRNA; STD; PLN; 733 BP.
JF957836;
Brassica napus NAC2 mRNA, partial cds.

JF957837; SV 1; linear; mRNA; STD; PLN; 750 BP.
JF957837;
Brassica napus NAC5 mRNA, complete cds.


19/11/2012

JX683732; SV 1; linear; mRNA; STD; PLN; 1603 BP.
JX683732;
Brassica napus MAPK7-1 (MAPK7-1) mRNA, complete cds.

JX827378; SV 1; linear; mRNA; STD; PLN; 1444 BP.
JX827378;
Brassica napus MAPK7-2 (MAPK7-2) mRNA, complete cds.

JX827379; SV 1; linear; mRNA; STD; PLN; 1557 BP.
JX827379;
Brassica napus MAPK7-3 (MAPK7-3) mRNA, complete cds.

JX827380; SV 1; linear; genomic DNA; STD; PLN; 1452 BP.
JX827380;
Brassica napus MAPK7-1 gene, promoter region.

JX827381; SV 1; linear; genomic DNA; STD; PLN; 1058 BP.
JX827381;
Brassica napus MAPK7-2 gene, promoter region.


17/11/2012

AB682783; SV 1; linear; genomic DNA; STD; PLN; 1652 BP.
AB682783;
Brassica rapa subsp. pekinensis FLC1 gene for FLOWERING LOCUS C, partial cds, cultivar: Muso.

AB682784; SV 1; linear; genomic DNA; STD; PLN; 1652 BP.
AB682784;
Brassica rapa subsp. pekinensis FLC1 gene for FLOWERING LOCUS C, partial cds, cultivar: Leafy Green Parental Line No.2.

AB682785; SV 1; linear; genomic DNA; STD; PLN; 1811 BP.
AB682785;
Brassica rapa subsp. pekinensis FLC2 gene for FLOWERING LOCUS C, partial cds, cultivar: Muso.

AB682786; SV 1; linear; genomic DNA; STD; PLN; 6848 BP.
AB682786;
Brassica rapa subsp. pekinensis FLC2 gene for FLOWERING LOCUS C, partial cds, cultivar: Leafy Green Parental Line No.2.

AB682787; SV 1; linear; genomic DNA; STD; PLN; 2896 BP.
AB682787;
Brassica rapa subsp. pekinensis FLC3' gene for FLOWERING LOCUS C, partial cds, cultivar: Muso.

AB682788; SV 1; linear; genomic DNA; STD; PLN; 8566 BP.
AB682788;
Brassica rapa subsp. pekinensis FLC3' gene for FLOWERING LOCUS C, partial cds, cultivar: Leafy Green Parental Line No.2.

AB682789; SV 1; linear; genomic DNA; STD; PLN; 7029 BP.
AB682789;
Brassica rapa subsp. pekinensis FLC3 gene for FLOWERING LOCUS C, partial cds, cultivar: Leafy Green Parental Line No.2.

AB682790; SV 1; linear; genomic DNA; STD; PLN; 2944 BP.
AB682790;
Brassica rapa subsp. pekinensis FLC3 gene for FLOWERING LOCUS C, partial cds, cultivar: Muso.

AB682791; SV 1; linear; genomic DNA; STD; PLN; 2235 BP.
AB682791;
Brassica rapa subsp. pekinensis FLC5 gene for FLOWERING LOCUS C, partial cds, cultivar: Muso.

AB682792; SV 1; linear; genomic DNA; STD; PLN; 2218 BP.
AB682792;
Brassica rapa subsp. pekinensis FLC5 gene for FLOWERING LOCUS C, partial cds, cultivar: Leafy Green Parental Line No.2.

JN941761; SV 1; linear; mRNA; STD; PLN; 1081 BP.
JN941761;
Brassica rapa subsp. pekinensis ferritin 1 (Fer1) mRNA, complete cds.

JX682714; SV 1; linear; genomic DNA; STD; PLN; 3758 BP.
JX682714;
Brassica oleracea ribosomal protein S27a (S27a) and inner no outer (INO) genes, partial cds.


15/11/2012

JX885773; SV 1; linear; mRNA; STD; PLN; 1560 BP.
JX885773;
Brassica napus aluminum-activated citrate transporter (MATE) mRNA, complete cds.


12/11/2012

FJ965337; SV 1; linear; mRNA; STD; PLN; 387 BP.
FJ965337;
Brassica rapa subsp. pekinensis dormancy-associated protein 1 (DRM1) mRNA, complete cds.

FJ965338; SV 1; linear; mRNA; STD; PLN; 597 BP.
FJ965338;
Brassica rapa subsp. pekinensis auxin-repressed protein 1 (ARP1) mRNA, complete cds.

FJ969844; SV 1; linear; mRNA; STD; PLN; 491 BP.
FJ969844;
Brassica rapa subsp. pekinensis actin 1 (ACT1) mRNA, partial cds.


07/11/2012

JF751063; SV 1; linear; mRNA; STD; PLN; 1323 BP.
JF751063;
Brassica napus kinase CIPK6 (CIPK6) mRNA, complete cds.

JF751064; SV 1; linear; mRNA; STD; PLN; 642 BP.
JF751064;
Brassica napus CBL1 (CBL1) mRNA, complete cds.


01/11/2012

JN120758; SV 1; linear; mRNA; STD; PLN; 858 BP.
JN120758;
Brassica oleracea var. italica transcription factor WRKY3 (WRKY3) mRNA, complete cds.

JN795550; SV 1; linear; mRNA; STD; PLN; 1503 BP.
JN795550;
Brassica rapa subsp. campestris glutathione reductase mRNA, complete cds.

JN847837; SV 1; linear; genomic DNA; STD; PLN; 1152 BP.
JN847837;
Brassica napus ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, partial cds; chloroplast.

JN847838; SV 1; linear; genomic DNA; STD; PLN; 1152 BP.
JN847838;
Brassica oleracea ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, partial cds; chloroplast.

JN847839; SV 1; linear; genomic DNA; STD; PLN; 1152 BP.
JN847839;
Brassica rapa ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, partial cds; chloroplast.

JX082291; SV 1; linear; mRNA; STD; PLN; 1578 BP.
JX082291;
Brassica napus Na+/K+-H+ antiporter NHX6 mRNA, partial cds.

JX082292; SV 1; linear; mRNA; STD; PLN; 1574 BP.
JX082292;
Brassica oleracea Na+/K+-H+ antiporter NHX6 mRNA, partial cds.

JX193765; SV 1; linear; genomic DNA; STD; PLN; 10911 BP.
JX193765;
Brassica napus linkage-group A2 flowering locus T (FT) gene, promoter region.

JX193766; SV 1; linear; genomic DNA; STD; PLN; 7759 BP.
JX193766;
Brassica napus linkage-group C2 flowering locus T (FT) gene, promoter region.

JX193767; SV 1; linear; genomic DNA; STD; PLN; 4716 BP.
JX193767;
Brassica napus linkage-group C6 flowering locus T (FT) gene, promoter region.

JX193768; SV 1; linear; genomic DNA; STD; PLN; 4698 BP.
JX193768;
Brassica napus linkage-group C6 flowering locus T (FT) gene, promoter region.


29/10/2012

JX494286; SV 1; linear; genomic DNA; STD; PLN; 2530 BP.
JX494286;
Brassica oleracea var. oleracea auxin response factor 10 gene, complete cds.

JX494287; SV 1; linear; genomic DNA; STD; PLN; 2523 BP.
JX494287;
Brassica rapa subsp. rapa auxin response factor 10 gene, complete cds.


25/10/2012

JX535391; SV 1; linear; mRNA; STD; PLN; 1626 BP.
JX535391;
Brassica napus cytochrome P450 79B1 mRNA, complete cds.


24/10/2012

EL622496; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL622496;
EST0001 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001A011, mRNA sequence.

EL622497; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL622497;
EST0002 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001A111, mRNA sequence.

EL622498; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622498;
EST0003 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001B011, mRNA sequence.

EL622499; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622499;
EST0004 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001B031, mRNA sequence.

EL622500; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622500;
EST0005 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001B051, mRNA sequence.

EL622501; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622501;
EST0006 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001B081, mRNA sequence.

EL622502; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL622502;
EST0007 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001B121, mRNA sequence.

EL622503; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622503;
EST0008 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001C021, mRNA sequence.

EL622504; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622504;
EST0009 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001C071, mRNA sequence.

EL622505; SV 1; linear; mRNA; EST; PLN; 682 BP.
EL622505;
EST0010 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001C081, mRNA sequence.

EL622506; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL622506;
EST0011 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001C111, mRNA sequence.

EL622507; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL622507;
EST0012 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001C121, mRNA sequence.

EL622508; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL622508;
EST0013 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001D021, mRNA sequence.

EL622509; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL622509;
EST0014 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001D081, mRNA sequence.

EL622510; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL622510;
EST0015 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001D091, mRNA sequence.

EL622511; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL622511;
EST0016 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001D101, mRNA sequence.

EL622512; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL622512;
EST0017 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001D111, mRNA sequence.

EL622513; SV 1; linear; mRNA; EST; PLN; 651 BP.
EL622513;
EST0018 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001E041, mRNA sequence.

EL622514; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622514;
EST0019 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001E051, mRNA sequence.

EL622515; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL622515;
EST0020 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001E061, mRNA sequence.

EL622516; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL622516;
EST0021 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001E071, mRNA sequence.

EL622517; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL622517;
EST0022 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001E091, mRNA sequence.

EL622518; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622518;
EST0023 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001E111, mRNA sequence.

EL622519; SV 1; linear; mRNA; EST; PLN; 675 BP.
EL622519;
EST0024 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001F011, mRNA sequence.

EL622520; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622520;
EST0025 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001F051, mRNA sequence.

EL622521; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL622521;
EST0026 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001F101, mRNA sequence.

EL622522; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL622522;
EST0027 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001F111, mRNA sequence.

EL622523; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL622523;
EST0028 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001G061, mRNA sequence.

EL622524; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL622524;
EST0029 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001G121, mRNA sequence.

EL622525; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622525;
EST0030 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001H041, mRNA sequence.

EL622526; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622526;
EST0031 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001H061, mRNA sequence.

EL622527; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL622527;
EST0032 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001H091, mRNA sequence.

EL622528; SV 1; linear; mRNA; EST; PLN; 708 BP.
EL622528;
EST0033 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B001H111, mRNA sequence.

EL622529; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL622529;
EST0034 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002A031, mRNA sequence.

EL622530; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL622530;
EST0035 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002A121, mRNA sequence.

EL622531; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL622531;
EST0036 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002B011, mRNA sequence.

EL622532; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL622532;
EST0037 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002B041, mRNA sequence.

EL622533; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL622533;
EST0038 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002B061, mRNA sequence.

EL622534; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622534;
EST0039 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002B081, mRNA sequence.

EL622535; SV 1; linear; mRNA; EST; PLN; 677 BP.
EL622535;
EST0040 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002C011, mRNA sequence.

EL622536; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL622536;
EST0041 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002C041, mRNA sequence.

EL622537; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL622537;
EST0042 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002C101, mRNA sequence.

EL622538; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622538;
EST0043 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002C121, mRNA sequence.

EL622539; SV 1; linear; mRNA; EST; PLN; 674 BP.
EL622539;
EST0044 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002D011, mRNA sequence.

EL622540; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL622540;
EST0045 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002D051, mRNA sequence.

EL622541; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL622541;
EST0046 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002D071, mRNA sequence.

EL622542; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL622542;
EST0047 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002D101, mRNA sequence.

EL622543; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622543;
EST0048 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002E021, mRNA sequence.

EL622544; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL622544;
EST0049 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002E041, mRNA sequence.

EL622545; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622545;
EST0050 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002E051, mRNA sequence.

EL622546; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622546;
EST0051 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002E091, mRNA sequence.

EL622547; SV 1; linear; mRNA; EST; PLN; 672 BP.
EL622547;
EST0052 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002F011, mRNA sequence.

EL622548; SV 1; linear; mRNA; EST; PLN; 683 BP.
EL622548;
EST0053 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002F031, mRNA sequence.

EL622549; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL622549;
EST0054 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002F111, mRNA sequence.

EL622550; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL622550;
EST0055 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002G051, mRNA sequence.

EL622551; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL622551;
EST0056 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002G061, mRNA sequence.

EL622552; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622552;
EST0057 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002G091, mRNA sequence.

EL622553; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL622553;
EST0058 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002G111, mRNA sequence.

EL622554; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL622554;
EST0059 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002H021, mRNA sequence.

EL622555; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL622555;
EST0060 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002H061, mRNA sequence.

EL622556; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL622556;
EST0061 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002H081, mRNA sequence.

EL622557; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL622557;
EST0062 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002H091, mRNA sequence.

EL622558; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL622558;
EST0063 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B002H101, mRNA sequence.

EL622559; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622559;
EST0064 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003A041, mRNA sequence.

EL622560; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL622560;
EST0065 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003A061, mRNA sequence.

EL622561; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL622561;
EST0066 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003B051, mRNA sequence.

EL622562; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL622562;
EST0067 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003B101, mRNA sequence.

EL622563; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL622563;
EST0068 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003B121, mRNA sequence.

EL622564; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL622564;
EST0069 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003C041, mRNA sequence.

EL622565; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622565;
EST0070 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003C051, mRNA sequence.

EL622566; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622566;
EST0071 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003C071, mRNA sequence.

EL622567; SV 1; linear; mRNA; EST; PLN; 675 BP.
EL622567;
EST0072 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003C081, mRNA sequence.

EL622568; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622568;
EST0073 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003C101, mRNA sequence.

EL622569; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL622569;
EST0074 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003D031, mRNA sequence.

EL622570; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622570;
EST0075 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003D041, mRNA sequence.

EL622571; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622571;
EST0076 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003D051, mRNA sequence.

EL622572; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL622572;
EST0077 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003D071, mRNA sequence.

EL622573; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622573;
EST0078 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003D081, mRNA sequence.

EL622574; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL622574;
EST0079 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003D111, mRNA sequence.

EL622575; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622575;
EST0080 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003E011, mRNA sequence.

EL622576; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL622576;
EST0081 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003E021, mRNA sequence.

EL622577; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622577;
EST0082 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003E031, mRNA sequence.

EL622578; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL622578;
EST0083 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003E061, mRNA sequence.

EL622579; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL622579;
EST0084 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003E121, mRNA sequence.

EL622580; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622580;
EST0085 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003F011, mRNA sequence.

EL622581; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622581;
EST0086 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003F021, mRNA sequence.

EL622582; SV 1; linear; mRNA; EST; PLN; 681 BP.
EL622582;
EST0087 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003F031, mRNA sequence.

EL622583; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622583;
EST0088 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003F081, mRNA sequence.

EL622584; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622584;
EST0089 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003F101, mRNA sequence.

EL622585; SV 1; linear; mRNA; EST; PLN; 769 BP.
EL622585;
EST0090 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003F121, mRNA sequence.

EL622586; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL622586;
EST0091 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003G011, mRNA sequence.

EL622587; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622587;
EST0092 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003G021, mRNA sequence.

EL622588; SV 1; linear; mRNA; EST; PLN; 668 BP.
EL622588;
EST0093 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003G041, mRNA sequence.

EL622589; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL622589;
EST0094 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003G051, mRNA sequence.

EL622590; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622590;
EST0095 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003G071, mRNA sequence.

EL622591; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622591;
EST0096 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003G091, mRNA sequence.

EL622592; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622592;
EST0097 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003G101, mRNA sequence.

EL622593; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL622593;
EST0098 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003H061, mRNA sequence.

EL622594; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622594;
EST0099 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003H071, mRNA sequence.

EL622595; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL622595;
EST0100 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003H091, mRNA sequence.

EL622596; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622596;
EST0101 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B003H121, mRNA sequence.

EL622597; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622597;
EST0102 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004A061, mRNA sequence.

EL622598; SV 1; linear; mRNA; EST; PLN; 687 BP.
EL622598;
EST0103 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004B031, mRNA sequence.

EL622599; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL622599;
EST0104 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004B051, mRNA sequence.

EL622600; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622600;
EST0105 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004B061, mRNA sequence.

EL622601; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622601;
EST0106 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004B071, mRNA sequence.

EL622602; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL622602;
EST0107 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004B081, mRNA sequence.

EL622603; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622603;
EST0108 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004B091, mRNA sequence.

EL622604; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622604;
EST0109 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004B101, mRNA sequence.

EL622605; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622605;
EST0110 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004C041, mRNA sequence.

EL622606; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622606;
EST0111 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004C051, mRNA sequence.

EL622607; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622607;
EST0112 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004C061, mRNA sequence.

EL622608; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622608;
EST0113 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004C071, mRNA sequence.

EL622609; SV 1; linear; mRNA; EST; PLN; 675 BP.
EL622609;
EST0114 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004C081, mRNA sequence.

EL622610; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622610;
EST0115 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004C101, mRNA sequence.

EL622611; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL622611;
EST0116 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004C121, mRNA sequence.

EL622612; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622612;
EST0117 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004D041, mRNA sequence.

EL622613; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL622613;
EST0118 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004D071, mRNA sequence.

EL622614; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL622614;
EST0119 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004D081, mRNA sequence.

EL622615; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622615;
EST0120 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004D101, mRNA sequence.

EL622616; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL622616;
EST0121 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004E021, mRNA sequence.

EL622617; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622617;
EST0122 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004E031, mRNA sequence.

EL622618; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL622618;
EST0123 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004E041, mRNA sequence.

EL622619; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622619;
EST0124 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004E061, mRNA sequence.

EL622620; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL622620;
EST0125 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004E101, mRNA sequence.

EL622621; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL622621;
EST0126 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004E111, mRNA sequence.

EL622622; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL622622;
EST0127 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004E121, mRNA sequence.

EL622623; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL622623;
EST0128 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004F021, mRNA sequence.

EL622624; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL622624;
EST0129 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004F101, mRNA sequence.

EL622625; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL622625;
EST0130 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004F121, mRNA sequence.

EL622626; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622626;
EST0131 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004G051, mRNA sequence.

EL622627; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL622627;
EST0132 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004G061, mRNA sequence.

EL622628; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL622628;
EST0133 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004G071, mRNA sequence.

EL622629; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622629;
EST0134 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004G081, mRNA sequence.

EL622630; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL622630;
EST0135 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004G121, mRNA sequence.

EL622631; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL622631;
EST0136 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004H051, mRNA sequence.

EL622632; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL622632;
EST0137 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004H081, mRNA sequence.

EL622633; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL622633;
EST0138 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004H091, mRNA sequence.

EL622634; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL622634;
EST0139 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004H101, mRNA sequence.

EL622635; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622635;
EST0140 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B004H121, mRNA sequence.

EL622636; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL622636;
EST0141 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005A031, mRNA sequence.

EL622637; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL622637;
EST0142 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005A121, mRNA sequence.

EL622638; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL622638;
EST0143 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005B101, mRNA sequence.

EL622639; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL622639;
EST0144 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005B121, mRNA sequence.

EL622640; SV 1; linear; mRNA; EST; PLN; 602 BP.
EL622640;
EST0145 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005C021, mRNA sequence.

EL622641; SV 1; linear; mRNA; EST; PLN; 311 BP.
EL622641;
EST0146 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005C031, mRNA sequence.

EL622642; SV 1; linear; mRNA; EST; PLN; 604 BP.
EL622642;
EST0147 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005C101, mRNA sequence.

EL622643; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL622643;
EST0148 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005D021, mRNA sequence.

EL622644; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL622644;
EST0149 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005D041, mRNA sequence.

EL622645; SV 1; linear; mRNA; EST; PLN; 264 BP.
EL622645;
EST0150 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005D051, mRNA sequence.

EL622646; SV 1; linear; mRNA; EST; PLN; 619 BP.
EL622646;
EST0151 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005D081, mRNA sequence.

EL622647; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL622647;
EST0152 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005E011, mRNA sequence.

EL622648; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL622648;
EST0153 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005E021, mRNA sequence.

EL622649; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL622649;
EST0154 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005E091, mRNA sequence.

EL622650; SV 1; linear; mRNA; EST; PLN; 453 BP.
EL622650;
EST0155 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005F011, mRNA sequence.

EL622651; SV 1; linear; mRNA; EST; PLN; 254 BP.
EL622651;
EST0156 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005F031, mRNA sequence.

EL622652; SV 1; linear; mRNA; EST; PLN; 620 BP.
EL622652;
EST0157 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005F041, mRNA sequence.

EL622653; SV 1; linear; mRNA; EST; PLN; 439 BP.
EL622653;
EST0158 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005F071, mRNA sequence.

EL622654; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL622654;
EST0159 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005F111, mRNA sequence.

EL622655; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL622655;
EST0160 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005H041, mRNA sequence.

EL622656; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL622656;
EST0161 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005H071, mRNA sequence.

EL622657; SV 1; linear; mRNA; EST; PLN; 500 BP.
EL622657;
EST0162 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005H101, mRNA sequence.

EL622658; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL622658;
EST0163 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B005H111, mRNA sequence.

EL622659; SV 1; linear; mRNA; EST; PLN; 722 BP.
EL622659;
EST0164 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006A041, mRNA sequence.

EL622660; SV 1; linear; mRNA; EST; PLN; 741 BP.
EL622660;
EST0165 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006A051, mRNA sequence.

EL622661; SV 1; linear; mRNA; EST; PLN; 837 BP.
EL622661;
EST0166 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006A091, mRNA sequence.

EL622662; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL622662;
EST0167 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006A101, mRNA sequence.

EL622663; SV 1; linear; mRNA; EST; PLN; 673 BP.
EL622663;
EST0168 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006A111, mRNA sequence.

EL622664; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL622664;
EST0169 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006A121, mRNA sequence.

EL622665; SV 1; linear; mRNA; EST; PLN; 717 BP.
EL622665;
EST0170 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006B021, mRNA sequence.

EL622666; SV 1; linear; mRNA; EST; PLN; 631 BP.
EL622666;
EST0171 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006B051, mRNA sequence.

EL622667; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL622667;
EST0172 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006C111, mRNA sequence.

EL622668; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL622668;
EST0173 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006D041, mRNA sequence.

EL622669; SV 1; linear; mRNA; EST; PLN; 290 BP.
EL622669;
EST0174 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006D071, mRNA sequence.

EL622670; SV 1; linear; mRNA; EST; PLN; 860 BP.
EL622670;
EST0175 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006D121, mRNA sequence.

EL622671; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL622671;
EST0176 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006E081, mRNA sequence.

EL622672; SV 1; linear; mRNA; EST; PLN; 743 BP.
EL622672;
EST0177 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006E091, mRNA sequence.

EL622673; SV 1; linear; mRNA; EST; PLN; 725 BP.
EL622673;
EST0178 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006E101, mRNA sequence.

EL622674; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL622674;
EST0179 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006F021, mRNA sequence.

EL622675; SV 1; linear; mRNA; EST; PLN; 631 BP.
EL622675;
EST0180 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006F111, mRNA sequence.

EL622676; SV 1; linear; mRNA; EST; PLN; 809 BP.
EL622676;
EST0181 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006G031, mRNA sequence.

EL622677; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL622677;
EST0182 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B006H051, mRNA sequence.

EL622678; SV 1; linear; mRNA; EST; PLN; 839 BP.
EL622678;
EST0183 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007A081, mRNA sequence.

EL622679; SV 1; linear; mRNA; EST; PLN; 202 BP.
EL622679;
EST0184 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007B041, mRNA sequence.

EL622680; SV 1; linear; mRNA; EST; PLN; 244 BP.
EL622680;
EST0185 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007B051, mRNA sequence.

EL622681; SV 1; linear; mRNA; EST; PLN; 463 BP.
EL622681;
EST0186 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007B061, mRNA sequence.

EL622682; SV 1; linear; mRNA; EST; PLN; 353 BP.
EL622682;
EST0187 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007C021, mRNA sequence.

EL622683; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL622683;
EST0188 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007C041, mRNA sequence.

EL622684; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL622684;
EST0189 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007C061, mRNA sequence.

EL622685; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622685;
EST0190 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007C091, mRNA sequence.

EL622686; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL622686;
EST0191 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007C121, mRNA sequence.

EL622687; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL622687;
EST0192 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007D021, mRNA sequence.

EL622688; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL622688;
EST0193 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007D111, mRNA sequence.

EL622689; SV 1; linear; mRNA; EST; PLN; 483 BP.
EL622689;
EST0194 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007E031, mRNA sequence.

EL622690; SV 1; linear; mRNA; EST; PLN; 478 BP.
EL622690;
EST0195 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007E081, mRNA sequence.

EL622691; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL622691;
EST0196 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007E091, mRNA sequence.

EL622692; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL622692;
EST0197 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007E101, mRNA sequence.

EL622693; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL622693;
EST0198 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007E111, mRNA sequence.

EL622694; SV 1; linear; mRNA; EST; PLN; 811 BP.
EL622694;
EST0199 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007F101, mRNA sequence.

EL622695; SV 1; linear; mRNA; EST; PLN; 373 BP.
EL622695;
EST0200 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007G041, mRNA sequence.

EL622696; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL622696;
EST0201 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007G051, mRNA sequence.

EL622697; SV 1; linear; mRNA; EST; PLN; 451 BP.
EL622697;
EST0202 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007G111, mRNA sequence.

EL622698; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL622698;
EST0203 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007H051, mRNA sequence.

EL622699; SV 1; linear; mRNA; EST; PLN; 458 BP.
EL622699;
EST0204 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007H091, mRNA sequence.

EL622700; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL622700;
EST0205 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B007H121, mRNA sequence.

EL622701; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL622701;
EST0206 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008A051, mRNA sequence.

EL622702; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL622702;
EST0207 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008A061, mRNA sequence.

EL622703; SV 1; linear; mRNA; EST; PLN; 375 BP.
EL622703;
EST0208 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008A101, mRNA sequence.

EL622704; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL622704;
EST0209 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008B031, mRNA sequence.

EL622705; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL622705;
EST0210 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008B061, mRNA sequence.

EL622706; SV 1; linear; mRNA; EST; PLN; 493 BP.
EL622706;
EST0211 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008B121, mRNA sequence.

EL622707; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL622707;
EST0212 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008C011, mRNA sequence.

EL622708; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL622708;
EST0213 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008C081, mRNA sequence.

EL622709; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL622709;
EST0214 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008D021, mRNA sequence.

EL622710; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL622710;
EST0215 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008D051, mRNA sequence.

EL622711; SV 1; linear; mRNA; EST; PLN; 394 BP.
EL622711;
EST0216 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008D121, mRNA sequence.

EL622712; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL622712;
EST0217 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008E011, mRNA sequence.

EL622713; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL622713;
EST0218 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008E021, mRNA sequence.

EL622714; SV 1; linear; mRNA; EST; PLN; 453 BP.
EL622714;
EST0219 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008E041, mRNA sequence.

EL622715; SV 1; linear; mRNA; EST; PLN; 389 BP.
EL622715;
EST0220 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008E091, mRNA sequence.

EL622716; SV 1; linear; mRNA; EST; PLN; 411 BP.
EL622716;
EST0221 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008E121, mRNA sequence.

EL622717; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL622717;
EST0222 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008F041, mRNA sequence.

EL622718; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL622718;
EST0223 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008F091, mRNA sequence.

EL622719; SV 1; linear; mRNA; EST; PLN; 783 BP.
EL622719;
EST0224 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008F101, mRNA sequence.

EL622720; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL622720;
EST0225 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B008F111, mRNA sequence.

EL622721; SV 1; linear; mRNA; EST; PLN; 552 BP.
EL622721;
EST0226 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009A021, mRNA sequence.

EL622722; SV 1; linear; mRNA; EST; PLN; 816 BP.
EL622722;
EST0227 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009C091, mRNA sequence.

EL622723; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL622723;
EST0228 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009D021, mRNA sequence.

EL622724; SV 1; linear; mRNA; EST; PLN; 743 BP.
EL622724;
EST0229 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009F011, mRNA sequence.

EL622725; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL622725;
EST0230 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009F021, mRNA sequence.

EL622726; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL622726;
EST0231 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009F031, mRNA sequence.

EL622727; SV 1; linear; mRNA; EST; PLN; 367 BP.
EL622727;
EST0232 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009F041, mRNA sequence.

EL622728; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL622728;
EST0233 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009F071, mRNA sequence.

EL622729; SV 1; linear; mRNA; EST; PLN; 820 BP.
EL622729;
EST0234 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009F091, mRNA sequence.

EL622730; SV 1; linear; mRNA; EST; PLN; 725 BP.
EL622730;
EST0235 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B009F101, mRNA sequence.

EL622731; SV 1; linear; mRNA; EST; PLN; 372 BP.
EL622731;
EST0236 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010A011, mRNA sequence.

EL622732; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL622732;
EST0237 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010A051, mRNA sequence.

EL622733; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL622733;
EST0238 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010A061, mRNA sequence.

EL622734; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL622734;
EST0239 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010B031, mRNA sequence.

EL622735; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL622735;
EST0240 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010B041, mRNA sequence.

EL622736; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL622736;
EST0241 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010B091, mRNA sequence.

EL622737; SV 1; linear; mRNA; EST; PLN; 731 BP.
EL622737;
EST0242 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010B111, mRNA sequence.

EL622738; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL622738;
EST0243 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010C031, mRNA sequence.

EL622739; SV 1; linear; mRNA; EST; PLN; 403 BP.
EL622739;
EST0244 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010C041, mRNA sequence.

EL622740; SV 1; linear; mRNA; EST; PLN; 737 BP.
EL622740;
EST0245 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010C051, mRNA sequence.

EL622741; SV 1; linear; mRNA; EST; PLN; 780 BP.
EL622741;
EST0246 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010D091, mRNA sequence.

EL622742; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL622742;
EST0247 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010D121, mRNA sequence.

EL622743; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL622743;
EST0248 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010E041, mRNA sequence.

EL622744; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL622744;
EST0249 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010E071, mRNA sequence.

EL622745; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL622745;
EST0250 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010F081, mRNA sequence.

EL622746; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL622746;
EST0251 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010G081, mRNA sequence.

EL622747; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL622747;
EST0252 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B010H121, mRNA sequence.

EL622748; SV 1; linear; mRNA; EST; PLN; 634 BP.
EL622748;
EST0253 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011A011, mRNA sequence.

EL622749; SV 1; linear; mRNA; EST; PLN; 525 BP.
EL622749;
EST0254 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011A031, mRNA sequence.

EL622750; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL622750;
EST0255 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011A091, mRNA sequence.

EL622751; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL622751;
EST0256 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011A121, mRNA sequence.

EL622752; SV 1; linear; mRNA; EST; PLN; 249 BP.
EL622752;
EST0257 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011B011, mRNA sequence.

EL622753; SV 1; linear; mRNA; EST; PLN; 383 BP.
EL622753;
EST0258 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011B031, mRNA sequence.

EL622754; SV 1; linear; mRNA; EST; PLN; 219 BP.
EL622754;
EST0259 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011B081, mRNA sequence.

EL622755; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL622755;
EST0260 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011C071, mRNA sequence.

EL622756; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL622756;
EST0261 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011C091, mRNA sequence.

EL622757; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL622757;
EST0262 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011C111, mRNA sequence.

EL622758; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL622758;
EST0263 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011D031, mRNA sequence.

EL622759; SV 1; linear; mRNA; EST; PLN; 215 BP.
EL622759;
EST0264 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011D041, mRNA sequence.

EL622760; SV 1; linear; mRNA; EST; PLN; 666 BP.
EL622760;
EST0265 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011D081, mRNA sequence.

EL622761; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL622761;
EST0266 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011D121, mRNA sequence.

EL622762; SV 1; linear; mRNA; EST; PLN; 388 BP.
EL622762;
EST0267 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011E021, mRNA sequence.

EL622763; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL622763;
EST0268 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011E071, mRNA sequence.

EL622764; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL622764;
EST0269 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011E081, mRNA sequence.

EL622765; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL622765;
EST0270 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011E121, mRNA sequence.

EL622766; SV 1; linear; mRNA; EST; PLN; 920 BP.
EL622766;
EST0271 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011F021, mRNA sequence.

EL622767; SV 1; linear; mRNA; EST; PLN; 656 BP.
EL622767;
EST0272 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011F031, mRNA sequence.

EL622768; SV 1; linear; mRNA; EST; PLN; 740 BP.
EL622768;
EST0273 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011F051, mRNA sequence.

EL622769; SV 1; linear; mRNA; EST; PLN; 751 BP.
EL622769;
EST0274 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011F071, mRNA sequence.

EL622770; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL622770;
EST0275 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011F121, mRNA sequence.

EL622771; SV 1; linear; mRNA; EST; PLN; 419 BP.
EL622771;
EST0276 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011G051, mRNA sequence.

EL622772; SV 1; linear; mRNA; EST; PLN; 504 BP.
EL622772;
EST0277 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011G071, mRNA sequence.

EL622773; SV 1; linear; mRNA; EST; PLN; 405 BP.
EL622773;
EST0278 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011G111, mRNA sequence.

EL622774; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL622774;
EST0279 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011H061, mRNA sequence.

EL622775; SV 1; linear; mRNA; EST; PLN; 401 BP.
EL622775;
EST0280 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B011H121, mRNA sequence.

EL622776; SV 1; linear; mRNA; EST; PLN; 621 BP.
EL622776;
EST0281 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012A031, mRNA sequence.

EL622777; SV 1; linear; mRNA; EST; PLN; 190 BP.
EL622777;
EST0282 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012A071, mRNA sequence.

EL622778; SV 1; linear; mRNA; EST; PLN; 783 BP.
EL622778;
EST0283 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012A121, mRNA sequence.

EL622779; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL622779;
EST0284 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012B021, mRNA sequence.

EL622780; SV 1; linear; mRNA; EST; PLN; 669 BP.
EL622780;
EST0285 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012B041, mRNA sequence.

EL622781; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL622781;
EST0286 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012B051, mRNA sequence.

EL622782; SV 1; linear; mRNA; EST; PLN; 1426 BP.
EL622782;
EST0287 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012B091, mRNA sequence.

EL622783; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL622783;
EST0288 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012C031, mRNA sequence.

EL622784; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL622784;
EST0289 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012C061, mRNA sequence.

EL622785; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL622785;
EST0290 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012D021, mRNA sequence.

EL622786; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL622786;
EST0291 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012D071, mRNA sequence.

EL622787; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL622787;
EST0292 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012E021, mRNA sequence.

EL622788; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL622788;
EST0293 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012E041, mRNA sequence.

EL622789; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL622789;
EST0294 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012E101, mRNA sequence.

EL622790; SV 1; linear; mRNA; EST; PLN; 382 BP.
EL622790;
EST0295 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012F011, mRNA sequence.

EL622791; SV 1; linear; mRNA; EST; PLN; 469 BP.
EL622791;
EST0296 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012F061, mRNA sequence.

EL622792; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL622792;
EST0297 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012G041, mRNA sequence.

EL622793; SV 1; linear; mRNA; EST; PLN; 494 BP.
EL622793;
EST0298 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012G061, mRNA sequence.

EL622794; SV 1; linear; mRNA; EST; PLN; 443 BP.
EL622794;
EST0299 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012G111, mRNA sequence.

EL622795; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL622795;
EST0300 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012H041, mRNA sequence.

EL622796; SV 1; linear; mRNA; EST; PLN; 363 BP.
EL622796;
EST0301 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B012H061, mRNA sequence.

EL622797; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL622797;
EST0302 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013A021, mRNA sequence.

EL622798; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL622798;
EST0303 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013A081, mRNA sequence.

EL622799; SV 1; linear; mRNA; EST; PLN; 632 BP.
EL622799;
EST0304 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013A091, mRNA sequence.

EL622800; SV 1; linear; mRNA; EST; PLN; 333 BP.
EL622800;
EST0305 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013A101, mRNA sequence.

EL622801; SV 1; linear; mRNA; EST; PLN; 805 BP.
EL622801;
EST0306 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013B011, mRNA sequence.

EL622802; SV 1; linear; mRNA; EST; PLN; 397 BP.
EL622802;
EST0307 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013B031, mRNA sequence.

EL622803; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL622803;
EST0308 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013B071, mRNA sequence.

EL622804; SV 1; linear; mRNA; EST; PLN; 214 BP.
EL622804;
EST0309 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013B111, mRNA sequence.

EL622805; SV 1; linear; mRNA; EST; PLN; 652 BP.
EL622805;
EST0310 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013B121, mRNA sequence.

EL622806; SV 1; linear; mRNA; EST; PLN; 354 BP.
EL622806;
EST0311 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013C091, mRNA sequence.

EL622807; SV 1; linear; mRNA; EST; PLN; 480 BP.
EL622807;
EST0312 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013C111, mRNA sequence.

EL622808; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL622808;
EST0313 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013D041, mRNA sequence.

EL622809; SV 1; linear; mRNA; EST; PLN; 205 BP.
EL622809;
EST0314 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013D081, mRNA sequence.

EL622810; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL622810;
EST0315 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013D101, mRNA sequence.

EL622811; SV 1; linear; mRNA; EST; PLN; 775 BP.
EL622811;
EST0316 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013E021, mRNA sequence.

EL622812; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL622812;
EST0317 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013E061, mRNA sequence.

EL622813; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL622813;
EST0318 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013E091, mRNA sequence.

EL622814; SV 1; linear; mRNA; EST; PLN; 619 BP.
EL622814;
EST0319 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013F091, mRNA sequence.

EL622815; SV 1; linear; mRNA; EST; PLN; 770 BP.
EL622815;
EST0320 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013F101, mRNA sequence.

EL622816; SV 1; linear; mRNA; EST; PLN; 255 BP.
EL622816;
EST0321 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013G011, mRNA sequence.

EL622817; SV 1; linear; mRNA; EST; PLN; 476 BP.
EL622817;
EST0322 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013G041, mRNA sequence.

EL622818; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL622818;
EST0323 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013G081, mRNA sequence.

EL622819; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL622819;
EST0324 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013G091, mRNA sequence.

EL622820; SV 1; linear; mRNA; EST; PLN; 631 BP.
EL622820;
EST0325 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013G101, mRNA sequence.

EL622821; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL622821;
EST0326 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013G121, mRNA sequence.

EL622822; SV 1; linear; mRNA; EST; PLN; 180 BP.
EL622822;
EST0327 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B013H011, mRNA sequence.

EL622823; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL622823;
EST0328 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014A011, mRNA sequence.

EL622824; SV 1; linear; mRNA; EST; PLN; 567 BP.
EL622824;
EST0329 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014A061, mRNA sequence.

EL622825; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL622825;
EST0330 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014A091, mRNA sequence.

EL622826; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL622826;
EST0331 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014A101, mRNA sequence.

EL622827; SV 1; linear; mRNA; EST; PLN; 552 BP.
EL622827;
EST0332 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014A121, mRNA sequence.

EL622828; SV 1; linear; mRNA; EST; PLN; 298 BP.
EL622828;
EST0333 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014B011, mRNA sequence.

EL622829; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL622829;
EST0334 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014B051, mRNA sequence.

EL622830; SV 1; linear; mRNA; EST; PLN; 525 BP.
EL622830;
EST0335 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014B071, mRNA sequence.

EL622831; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL622831;
EST0336 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014B091, mRNA sequence.

EL622832; SV 1; linear; mRNA; EST; PLN; 888 BP.
EL622832;
EST0337 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014B111, mRNA sequence.

EL622833; SV 1; linear; mRNA; EST; PLN; 543 BP.
EL622833;
EST0338 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014B121, mRNA sequence.

EL622834; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL622834;
EST0339 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014C021, mRNA sequence.

EL622835; SV 1; linear; mRNA; EST; PLN; 276 BP.
EL622835;
EST0340 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014C091, mRNA sequence.

EL622836; SV 1; linear; mRNA; EST; PLN; 380 BP.
EL622836;
EST0341 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014D071, mRNA sequence.

EL622837; SV 1; linear; mRNA; EST; PLN; 454 BP.
EL622837;
EST0342 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014E021, mRNA sequence.

EL622838; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL622838;
EST0343 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014E101, mRNA sequence.

EL622839; SV 1; linear; mRNA; EST; PLN; 871 BP.
EL622839;
EST0344 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014E121, mRNA sequence.

EL622840; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL622840;
EST0345 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014F011, mRNA sequence.

EL622841; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL622841;
EST0346 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014F051, mRNA sequence.

EL622842; SV 1; linear; mRNA; EST; PLN; 492 BP.
EL622842;
EST0347 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014F091, mRNA sequence.

EL622843; SV 1; linear; mRNA; EST; PLN; 776 BP.
EL622843;
EST0348 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014F121, mRNA sequence.

EL622844; SV 1; linear; mRNA; EST; PLN; 400 BP.
EL622844;
EST0349 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014G011, mRNA sequence.

EL622845; SV 1; linear; mRNA; EST; PLN; 358 BP.
EL622845;
EST0350 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014G021, mRNA sequence.

EL622846; SV 1; linear; mRNA; EST; PLN; 503 BP.
EL622846;
EST0351 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014G031, mRNA sequence.

EL622847; SV 1; linear; mRNA; EST; PLN; 397 BP.
EL622847;
EST0352 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014G071, mRNA sequence.

EL622848; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL622848;
EST0353 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014H051, mRNA sequence.

EL622849; SV 1; linear; mRNA; EST; PLN; 512 BP.
EL622849;
EST0354 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B014H071, mRNA sequence.

EL622850; SV 1; linear; mRNA; EST; PLN; 815 BP.
EL622850;
EST0355 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015A041, mRNA sequence.

EL622851; SV 1; linear; mRNA; EST; PLN; 708 BP.
EL622851;
EST0356 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015A051, mRNA sequence.

EL622852; SV 1; linear; mRNA; EST; PLN; 320 BP.
EL622852;
EST0357 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015A081, mRNA sequence.

EL622853; SV 1; linear; mRNA; EST; PLN; 879 BP.
EL622853;
EST0358 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015A101, mRNA sequence.

EL622854; SV 1; linear; mRNA; EST; PLN; 362 BP.
EL622854;
EST0359 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015A111, mRNA sequence.

EL622855; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL622855;
EST0360 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015A121, mRNA sequence.

EL622856; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL622856;
EST0361 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015B021, mRNA sequence.

EL622857; SV 1; linear; mRNA; EST; PLN; 376 BP.
EL622857;
EST0362 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015B031, mRNA sequence.

EL622858; SV 1; linear; mRNA; EST; PLN; 366 BP.
EL622858;
EST0363 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015D111, mRNA sequence.

EL622859; SV 1; linear; mRNA; EST; PLN; 353 BP.
EL622859;
EST0364 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015D121, mRNA sequence.

EL622860; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL622860;
EST0365 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015E041, mRNA sequence.

EL622861; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL622861;
EST0366 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015E051, mRNA sequence.

EL622862; SV 1; linear; mRNA; EST; PLN; 453 BP.
EL622862;
EST0367 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015E091, mRNA sequence.

EL622863; SV 1; linear; mRNA; EST; PLN; 387 BP.
EL622863;
EST0368 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015E111, mRNA sequence.

EL622864; SV 1; linear; mRNA; EST; PLN; 491 BP.
EL622864;
EST0369 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015F041, mRNA sequence.

EL622865; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL622865;
EST0370 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015F101, mRNA sequence.

EL622866; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL622866;
EST0371 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015F121, mRNA sequence.

EL622867; SV 1; linear; mRNA; EST; PLN; 860 BP.
EL622867;
EST0372 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015G021, mRNA sequence.

EL622868; SV 1; linear; mRNA; EST; PLN; 751 BP.
EL622868;
EST0373 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015G091, mRNA sequence.

EL622869; SV 1; linear; mRNA; EST; PLN; 867 BP.
EL622869;
EST0374 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B015H041, mRNA sequence.

EL622870; SV 1; linear; mRNA; EST; PLN; 437 BP.
EL622870;
EST0375 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016B021, mRNA sequence.

EL622871; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL622871;
EST0376 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016B111, mRNA sequence.

EL622872; SV 1; linear; mRNA; EST; PLN; 407 BP.
EL622872;
EST0377 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016C041, mRNA sequence.

EL622873; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL622873;
EST0378 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016C061, mRNA sequence.

EL622874; SV 1; linear; mRNA; EST; PLN; 589 BP.
EL622874;
EST0379 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016C081, mRNA sequence.

EL622875; SV 1; linear; mRNA; EST; PLN; 335 BP.
EL622875;
EST0380 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016C121, mRNA sequence.

EL622876; SV 1; linear; mRNA; EST; PLN; 617 BP.
EL622876;
EST0381 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016D091, mRNA sequence.

EL622877; SV 1; linear; mRNA; EST; PLN; 471 BP.
EL622877;
EST0382 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016F041, mRNA sequence.

EL622878; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL622878;
EST0383 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016F091, mRNA sequence.

EL622879; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL622879;
EST0384 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016G111, mRNA sequence.

EL622880; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL622880;
EST0385 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016G121, mRNA sequence.

EL622881; SV 1; linear; mRNA; EST; PLN; 643 BP.
EL622881;
EST0386 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016H101, mRNA sequence.

EL622882; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL622882;
EST0387 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B016H111, mRNA sequence.

EL622883; SV 1; linear; mRNA; EST; PLN; 463 BP.
EL622883;
EST0388 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017A011, mRNA sequence.

EL622884; SV 1; linear; mRNA; EST; PLN; 667 BP.
EL622884;
EST0389 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017A111, mRNA sequence.

EL622885; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL622885;
EST0390 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017B011, mRNA sequence.

EL622886; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL622886;
EST0391 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017B031, mRNA sequence.

EL622887; SV 1; linear; mRNA; EST; PLN; 792 BP.
EL622887;
EST0392 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017B121, mRNA sequence.

EL622888; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL622888;
EST0393 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017C051, mRNA sequence.

EL622889; SV 1; linear; mRNA; EST; PLN; 747 BP.
EL622889;
EST0394 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017C071, mRNA sequence.

EL622890; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL622890;
EST0395 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017C121, mRNA sequence.

EL622891; SV 1; linear; mRNA; EST; PLN; 891 BP.
EL622891;
EST0396 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017D121, mRNA sequence.

EL622892; SV 1; linear; mRNA; EST; PLN; 406 BP.
EL622892;
EST0397 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017E031, mRNA sequence.

EL622893; SV 1; linear; mRNA; EST; PLN; 750 BP.
EL622893;
EST0398 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017E071, mRNA sequence.

EL622894; SV 1; linear; mRNA; EST; PLN; 855 BP.
EL622894;
EST0399 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017E081, mRNA sequence.

EL622895; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL622895;
EST0400 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017E101, mRNA sequence.

EL622896; SV 1; linear; mRNA; EST; PLN; 846 BP.
EL622896;
EST0401 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017E111, mRNA sequence.

EL622897; SV 1; linear; mRNA; EST; PLN; 852 BP.
EL622897;
EST0402 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017E121, mRNA sequence.

EL622898; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL622898;
EST0403 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017F081, mRNA sequence.

EL622899; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL622899;
EST0404 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017F091, mRNA sequence.

EL622900; SV 1; linear; mRNA; EST; PLN; 910 BP.
EL622900;
EST0405 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017G071, mRNA sequence.

EL622901; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL622901;
EST0406 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017H051, mRNA sequence.

EL622902; SV 1; linear; mRNA; EST; PLN; 783 BP.
EL622902;
EST0407 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B017H121, mRNA sequence.

EL622903; SV 1; linear; mRNA; EST; PLN; 845 BP.
EL622903;
EST0408 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018A101, mRNA sequence.

EL622904; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL622904;
EST0409 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018A111, mRNA sequence.

EL622905; SV 1; linear; mRNA; EST; PLN; 687 BP.
EL622905;
EST0410 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018A121, mRNA sequence.

EL622906; SV 1; linear; mRNA; EST; PLN; 865 BP.
EL622906;
EST0411 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018B021, mRNA sequence.

EL622907; SV 1; linear; mRNA; EST; PLN; 659 BP.
EL622907;
EST0412 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018B041, mRNA sequence.

EL622908; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL622908;
EST0413 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018B081, mRNA sequence.

EL622909; SV 1; linear; mRNA; EST; PLN; 350 BP.
EL622909;
EST0414 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018B111, mRNA sequence.

EL622910; SV 1; linear; mRNA; EST; PLN; 428 BP.
EL622910;
EST0415 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018B121, mRNA sequence.

EL622911; SV 1; linear; mRNA; EST; PLN; 669 BP.
EL622911;
EST0416 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018C061, mRNA sequence.

EL622912; SV 1; linear; mRNA; EST; PLN; 371 BP.
EL622912;
EST0417 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018C081, mRNA sequence.

EL622913; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL622913;
EST0418 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018D051, mRNA sequence.

EL622914; SV 1; linear; mRNA; EST; PLN; 228 BP.
EL622914;
EST0419 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018D081, mRNA sequence.

EL622915; SV 1; linear; mRNA; EST; PLN; 234 BP.
EL622915;
EST0420 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018D121, mRNA sequence.

EL622916; SV 1; linear; mRNA; EST; PLN; 181 BP.
EL622916;
EST0421 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018E011, mRNA sequence.

EL622917; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL622917;
EST0422 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018E041, mRNA sequence.

EL622918; SV 1; linear; mRNA; EST; PLN; 272 BP.
EL622918;
EST0423 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018E051, mRNA sequence.

EL622919; SV 1; linear; mRNA; EST; PLN; 567 BP.
EL622919;
EST0424 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018E061, mRNA sequence.

EL622920; SV 1; linear; mRNA; EST; PLN; 824 BP.
EL622920;
EST0425 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018E071, mRNA sequence.

EL622921; SV 1; linear; mRNA; EST; PLN; 647 BP.
EL622921;
EST0426 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018E091, mRNA sequence.

EL622922; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL622922;
EST0427 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018F021, mRNA sequence.

EL622923; SV 1; linear; mRNA; EST; PLN; 732 BP.
EL622923;
EST0428 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018F051, mRNA sequence.

EL622924; SV 1; linear; mRNA; EST; PLN; 649 BP.
EL622924;
EST0429 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018F081, mRNA sequence.

EL622925; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL622925;
EST0430 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018F121, mRNA sequence.

EL622926; SV 1; linear; mRNA; EST; PLN; 293 BP.
EL622926;
EST0431 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018G061, mRNA sequence.

EL622927; SV 1; linear; mRNA; EST; PLN; 803 BP.
EL622927;
EST0432 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018G071, mRNA sequence.

EL622928; SV 1; linear; mRNA; EST; PLN; 362 BP.
EL622928;
EST0433 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018H061, mRNA sequence.

EL622929; SV 1; linear; mRNA; EST; PLN; 850 BP.
EL622929;
EST0434 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018H101, mRNA sequence.

EL622930; SV 1; linear; mRNA; EST; PLN; 864 BP.
EL622930;
EST0435 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018H111, mRNA sequence.

EL622931; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL622931;
EST0436 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B018H121, mRNA sequence.

EL622932; SV 1; linear; mRNA; EST; PLN; 390 BP.
EL622932;
EST0437 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019A031, mRNA sequence.

EL622933; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL622933;
EST0438 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019A101, mRNA sequence.

EL622934; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL622934;
EST0439 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019A111, mRNA sequence.

EL622935; SV 1; linear; mRNA; EST; PLN; 319 BP.
EL622935;
EST0440 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019B011, mRNA sequence.

EL622936; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL622936;
EST0441 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019B031, mRNA sequence.

EL622937; SV 1; linear; mRNA; EST; PLN; 384 BP.
EL622937;
EST0442 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019B081, mRNA sequence.

EL622938; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL622938;
EST0443 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019C051, mRNA sequence.

EL622939; SV 1; linear; mRNA; EST; PLN; 483 BP.
EL622939;
EST0444 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019C061, mRNA sequence.

EL622940; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL622940;
EST0445 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019C081, mRNA sequence.

EL622941; SV 1; linear; mRNA; EST; PLN; 244 BP.
EL622941;
EST0446 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019C111, mRNA sequence.

EL622942; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL622942;
EST0447 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019D011, mRNA sequence.

EL622943; SV 1; linear; mRNA; EST; PLN; 484 BP.
EL622943;
EST0448 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019D081, mRNA sequence.

EL622944; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL622944;
EST0449 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019E011, mRNA sequence.

EL622945; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL622945;
EST0450 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019E111, mRNA sequence.

EL622946; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL622946;
EST0451 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019G031, mRNA sequence.

EL622947; SV 1; linear; mRNA; EST; PLN; 469 BP.
EL622947;
EST0452 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019G071, mRNA sequence.

EL622948; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL622948;
EST0453 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019G081, mRNA sequence.

EL622949; SV 1; linear; mRNA; EST; PLN; 543 BP.
EL622949;
EST0454 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019G111, mRNA sequence.

EL622950; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL622950;
EST0455 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019H081, mRNA sequence.

EL622951; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL622951;
EST0456 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019H091, mRNA sequence.

EL622952; SV 1; linear; mRNA; EST; PLN; 503 BP.
EL622952;
EST0457 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B019H121, mRNA sequence.

EL622953; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL622953;
EST0458 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020A071, mRNA sequence.

EL622954; SV 1; linear; mRNA; EST; PLN; 637 BP.
EL622954;
EST0459 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020B011, mRNA sequence.

EL622955; SV 1; linear; mRNA; EST; PLN; 442 BP.
EL622955;
EST0461 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020B041, mRNA sequence.

EL622956; SV 1; linear; mRNA; EST; PLN; 408 BP.
EL622956;
EST0462 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020C031, mRNA sequence.

EL622957; SV 1; linear; mRNA; EST; PLN; 216 BP.
EL622957;
EST0463 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020C041, mRNA sequence.

EL622958; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL622958;
EST0464 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020C061, mRNA sequence.

EL622959; SV 1; linear; mRNA; EST; PLN; 411 BP.
EL622959;
EST0465 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020C111, mRNA sequence.

EL622960; SV 1; linear; mRNA; EST; PLN; 718 BP.
EL622960;
EST0466 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020D011, mRNA sequence.

EL622961; SV 1; linear; mRNA; EST; PLN; 751 BP.
EL622961;
EST0467 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020D021, mRNA sequence.

EL622962; SV 1; linear; mRNA; EST; PLN; 719 BP.
EL622962;
EST0468 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020D041, mRNA sequence.

EL622963; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL622963;
EST0469 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020D071, mRNA sequence.

EL622964; SV 1; linear; mRNA; EST; PLN; 420 BP.
EL622964;
EST0470 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020D111, mRNA sequence.

EL622965; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL622965;
EST0471 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020E091, mRNA sequence.

EL622966; SV 1; linear; mRNA; EST; PLN; 829 BP.
EL622966;
EST0472 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020F011, mRNA sequence.

EL622967; SV 1; linear; mRNA; EST; PLN; 645 BP.
EL622967;
EST0473 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020F021, mRNA sequence.

EL622968; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL622968;
EST0474 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020F061, mRNA sequence.

EL622969; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL622969;
EST0475 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020G081, mRNA sequence.

EL622970; SV 1; linear; mRNA; EST; PLN; 397 BP.
EL622970;
EST0476 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020G091, mRNA sequence.

EL622971; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL622971;
EST0477 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020G111, mRNA sequence.

EL622972; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL622972;
EST0478 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020H011, mRNA sequence.

EL622973; SV 1; linear; mRNA; EST; PLN; 394 BP.
EL622973;
EST0479 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B020H081, mRNA sequence.

EL622974; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL622974;
EST0480 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021A031, mRNA sequence.

EL622975; SV 1; linear; mRNA; EST; PLN; 550 BP.
EL622975;
EST0481 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021A051, mRNA sequence.

EL622976; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL622976;
EST0482 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021A061, mRNA sequence.

EL622977; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL622977;
EST0483 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021A101, mRNA sequence.

EL622978; SV 1; linear; mRNA; EST; PLN; 611 BP.
EL622978;
EST0484 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021B041, mRNA sequence.

EL622979; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL622979;
EST0485 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021B051, mRNA sequence.

EL622980; SV 1; linear; mRNA; EST; PLN; 251 BP.
EL622980;
EST0486 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021B071, mRNA sequence.

EL622981; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL622981;
EST0487 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021B101, mRNA sequence.

EL622982; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL622982;
EST0488 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021B121, mRNA sequence.

EL622983; SV 1; linear; mRNA; EST; PLN; 301 BP.
EL622983;
EST0489 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021C111, mRNA sequence.

EL622984; SV 1; linear; mRNA; EST; PLN; 421 BP.
EL622984;
EST0490 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021D021, mRNA sequence.

EL622985; SV 1; linear; mRNA; EST; PLN; 456 BP.
EL622985;
EST0491 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021D101, mRNA sequence.

EL622986; SV 1; linear; mRNA; EST; PLN; 405 BP.
EL622986;
EST0492 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021E021, mRNA sequence.

EL622987; SV 1; linear; mRNA; EST; PLN; 249 BP.
EL622987;
EST0493 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021E051, mRNA sequence.

EL622988; SV 1; linear; mRNA; EST; PLN; 327 BP.
EL622988;
EST0494 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021E091, mRNA sequence.

EL622989; SV 1; linear; mRNA; EST; PLN; 476 BP.
EL622989;
EST0495 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021E101, mRNA sequence.

EL622990; SV 1; linear; mRNA; EST; PLN; 394 BP.
EL622990;
EST0496 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021F041, mRNA sequence.

EL622991; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL622991;
EST0497 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021F121, mRNA sequence.

EL622992; SV 1; linear; mRNA; EST; PLN; 498 BP.
EL622992;
EST0498 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021G031, mRNA sequence.

EL622993; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL622993;
EST0499 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021G101, mRNA sequence.

EL622994; SV 1; linear; mRNA; EST; PLN; 490 BP.
EL622994;
EST0500 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021H051, mRNA sequence.

EL622995; SV 1; linear; mRNA; EST; PLN; 423 BP.
EL622995;
EST0501 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021H071, mRNA sequence.

EL622996; SV 1; linear; mRNA; EST; PLN; 369 BP.
EL622996;
EST0502 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B021H121, mRNA sequence.

EL622997; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL622997;
EST0503 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022A101, mRNA sequence.

EL622998; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL622998;
EST0504 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022B011, mRNA sequence.

EL622999; SV 1; linear; mRNA; EST; PLN; 263 BP.
EL622999;
EST0505 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022B031, mRNA sequence.

EL623000; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL623000;
EST0506 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022B061, mRNA sequence.

EL623001; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL623001;
EST0507 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022B081, mRNA sequence.

EL623002; SV 1; linear; mRNA; EST; PLN; 419 BP.
EL623002;
EST0508 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022B111, mRNA sequence.

EL623003; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL623003;
EST0509 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022B121, mRNA sequence.

EL623004; SV 1; linear; mRNA; EST; PLN; 359 BP.
EL623004;
EST0510 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022C031, mRNA sequence.

EL623005; SV 1; linear; mRNA; EST; PLN; 332 BP.
EL623005;
EST0511 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022C041, mRNA sequence.

EL623006; SV 1; linear; mRNA; EST; PLN; 504 BP.
EL623006;
EST0512 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022C121, mRNA sequence.

EL623007; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL623007;
EST0513 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022D011, mRNA sequence.

EL623008; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL623008;
EST0514 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022D061, mRNA sequence.

EL623009; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL623009;
EST0515 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022E041, mRNA sequence.

EL623010; SV 1; linear; mRNA; EST; PLN; 506 BP.
EL623010;
EST0516 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022E051, mRNA sequence.

EL623011; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL623011;
EST0517 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022E121, mRNA sequence.

EL623012; SV 1; linear; mRNA; EST; PLN; 394 BP.
EL623012;
EST0518 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022F041, mRNA sequence.

EL623013; SV 1; linear; mRNA; EST; PLN; 330 BP.
EL623013;
EST0519 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022F061, mRNA sequence.

EL623014; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL623014;
EST0520 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022F091, mRNA sequence.

EL623015; SV 1; linear; mRNA; EST; PLN; 299 BP.
EL623015;
EST0521 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022F101, mRNA sequence.

EL623016; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL623016;
EST0522 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022G041, mRNA sequence.

EL623017; SV 1; linear; mRNA; EST; PLN; 833 BP.
EL623017;
EST0523 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022H021, mRNA sequence.

EL623018; SV 1; linear; mRNA; EST; PLN; 414 BP.
EL623018;
EST0524 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022H031, mRNA sequence.

EL623019; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL623019;
EST0525 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B022H121, mRNA sequence.

EL623020; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL623020;
EST0526 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023A021, mRNA sequence.

EL623021; SV 1; linear; mRNA; EST; PLN; 382 BP.
EL623021;
EST0527 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023A071, mRNA sequence.

EL623022; SV 1; linear; mRNA; EST; PLN; 351 BP.
EL623022;
EST0528 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023B011, mRNA sequence.

EL623023; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL623023;
EST0529 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023B021, mRNA sequence.

EL623024; SV 1; linear; mRNA; EST; PLN; 476 BP.
EL623024;
EST0530 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023B071, mRNA sequence.

EL623025; SV 1; linear; mRNA; EST; PLN; 577 BP.
EL623025;
EST0531 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023B121, mRNA sequence.

EL623026; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL623026;
EST0532 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023C111, mRNA sequence.

EL623027; SV 1; linear; mRNA; EST; PLN; 443 BP.
EL623027;
EST0533 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023D011, mRNA sequence.

EL623028; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL623028;
EST0534 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023D061, mRNA sequence.

EL623029; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL623029;
EST0535 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023D121, mRNA sequence.

EL623030; SV 1; linear; mRNA; EST; PLN; 454 BP.
EL623030;
EST0536 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023E011, mRNA sequence.

EL623031; SV 1; linear; mRNA; EST; PLN; 402 BP.
EL623031;
EST0537 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023F041, mRNA sequence.

EL623032; SV 1; linear; mRNA; EST; PLN; 490 BP.
EL623032;
EST0538 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023F091, mRNA sequence.

EL623033; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL623033;
EST0539 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023F121, mRNA sequence.

EL623034; SV 1; linear; mRNA; EST; PLN; 495 BP.
EL623034;
EST0540 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023G031, mRNA sequence.

EL623035; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623035;
EST0541 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023G071, mRNA sequence.

EL623036; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL623036;
EST0542 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023G081, mRNA sequence.

EL623037; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL623037;
EST0543 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023G091, mRNA sequence.

EL623038; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL623038;
EST0544 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023H111, mRNA sequence.

EL623039; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL623039;
EST0545 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B023H121, mRNA sequence.

EL623040; SV 1; linear; mRNA; EST; PLN; 786 BP.
EL623040;
EST0546 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024A041, mRNA sequence.

EL623041; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL623041;
EST0547 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024A061, mRNA sequence.

EL623042; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL623042;
EST0548 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024B111, mRNA sequence.

EL623043; SV 1; linear; mRNA; EST; PLN; 363 BP.
EL623043;
EST0549 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024C011, mRNA sequence.

EL623044; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL623044;
EST0550 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024C091, mRNA sequence.

EL623045; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL623045;
EST0551 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024C101, mRNA sequence.

EL623046; SV 1; linear; mRNA; EST; PLN; 718 BP.
EL623046;
EST0552 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024D021, mRNA sequence.

EL623047; SV 1; linear; mRNA; EST; PLN; 726 BP.
EL623047;
EST0553 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024D081, mRNA sequence.

EL623048; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL623048;
EST0554 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024F101, mRNA sequence.

EL623049; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL623049;
EST0555 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024F111, mRNA sequence.

EL623050; SV 1; linear; mRNA; EST; PLN; 782 BP.
EL623050;
EST0556 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024G041, mRNA sequence.

EL623051; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL623051;
EST0557 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024G071, mRNA sequence.

EL623052; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL623052;
EST0558 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024G111, mRNA sequence.

EL623053; SV 1; linear; mRNA; EST; PLN; 777 BP.
EL623053;
EST0559 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B024H031, mRNA sequence.

EL623054; SV 1; linear; mRNA; EST; PLN; 604 BP.
EL623054;
EST0560 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025A071, mRNA sequence.

EL623055; SV 1; linear; mRNA; EST; PLN; 591 BP.
EL623055;
EST0561 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025A101, mRNA sequence.

EL623056; SV 1; linear; mRNA; EST; PLN; 327 BP.
EL623056;
EST0562 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025B031, mRNA sequence.

EL623057; SV 1; linear; mRNA; EST; PLN; 320 BP.
EL623057;
EST0563 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025B041, mRNA sequence.

EL623058; SV 1; linear; mRNA; EST; PLN; 838 BP.
EL623058;
EST0564 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025B111, mRNA sequence.

EL623059; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL623059;
EST0565 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025D101, mRNA sequence.

EL623060; SV 1; linear; mRNA; EST; PLN; 717 BP.
EL623060;
EST0566 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025E051, mRNA sequence.

EL623061; SV 1; linear; mRNA; EST; PLN; 851 BP.
EL623061;
EST0567 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025E061, mRNA sequence.

EL623062; SV 1; linear; mRNA; EST; PLN; 316 BP.
EL623062;
EST0568 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025E091, mRNA sequence.

EL623063; SV 1; linear; mRNA; EST; PLN; 753 BP.
EL623063;
EST0569 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025E121, mRNA sequence.

EL623064; SV 1; linear; mRNA; EST; PLN; 427 BP.
EL623064;
EST0570 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025F031, mRNA sequence.

EL623065; SV 1; linear; mRNA; EST; PLN; 367 BP.
EL623065;
EST0571 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025F101, mRNA sequence.

EL623066; SV 1; linear; mRNA; EST; PLN; 845 BP.
EL623066;
EST0572 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025G021, mRNA sequence.

EL623067; SV 1; linear; mRNA; EST; PLN; 828 BP.
EL623067;
EST0573 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025G031, mRNA sequence.

EL623068; SV 1; linear; mRNA; EST; PLN; 687 BP.
EL623068;
EST0574 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025G051, mRNA sequence.

EL623069; SV 1; linear; mRNA; EST; PLN; 494 BP.
EL623069;
EST0575 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025G081, mRNA sequence.

EL623070; SV 1; linear; mRNA; EST; PLN; 293 BP.
EL623070;
EST0576 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025G121, mRNA sequence.

EL623071; SV 1; linear; mRNA; EST; PLN; 722 BP.
EL623071;
EST0577 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025H031, mRNA sequence.

EL623072; SV 1; linear; mRNA; EST; PLN; 718 BP.
EL623072;
EST0578 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025H081, mRNA sequence.

EL623073; SV 1; linear; mRNA; EST; PLN; 882 BP.
EL623073;
EST0579 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B025H111, mRNA sequence.

EL623074; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL623074;
EST0580 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026A061, mRNA sequence.

EL623075; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL623075;
EST0581 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026B041, mRNA sequence.

EL623076; SV 1; linear; mRNA; EST; PLN; 812 BP.
EL623076;
EST0582 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026C041, mRNA sequence.

EL623077; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL623077;
EST0583 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026D031, mRNA sequence.

EL623078; SV 1; linear; mRNA; EST; PLN; 895 BP.
EL623078;
EST0584 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026D041, mRNA sequence.

EL623079; SV 1; linear; mRNA; EST; PLN; 314 BP.
EL623079;
EST0585 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026D051, mRNA sequence.

EL623080; SV 1; linear; mRNA; EST; PLN; 414 BP.
EL623080;
EST0586 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026D071, mRNA sequence.

EL623081; SV 1; linear; mRNA; EST; PLN; 385 BP.
EL623081;
EST0587 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026D081, mRNA sequence.

EL623082; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL623082;
EST0588 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026D101, mRNA sequence.

EL623083; SV 1; linear; mRNA; EST; PLN; 631 BP.
EL623083;
EST0589 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026D121, mRNA sequence.

EL623084; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL623084;
EST0590 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026E021, mRNA sequence.

EL623085; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL623085;
EST0591 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026E031, mRNA sequence.

EL623086; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL623086;
EST0592 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026E051, mRNA sequence.

EL623087; SV 1; linear; mRNA; EST; PLN; 466 BP.
EL623087;
EST0593 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026F081, mRNA sequence.

EL623088; SV 1; linear; mRNA; EST; PLN; 323 BP.
EL623088;
EST0594 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026G011, mRNA sequence.

EL623089; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL623089;
EST0595 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026G041, mRNA sequence.

EL623090; SV 1; linear; mRNA; EST; PLN; 803 BP.
EL623090;
EST0596 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026H021, mRNA sequence.

EL623091; SV 1; linear; mRNA; EST; PLN; 462 BP.
EL623091;
EST0597 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026H041, mRNA sequence.

EL623092; SV 1; linear; mRNA; EST; PLN; 481 BP.
EL623092;
EST0598 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026H051, mRNA sequence.

EL623093; SV 1; linear; mRNA; EST; PLN; 504 BP.
EL623093;
EST0599 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026H061, mRNA sequence.

EL623094; SV 1; linear; mRNA; EST; PLN; 501 BP.
EL623094;
EST0600 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B026H121, mRNA sequence.

EL623095; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL623095;
EST0601 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027A041, mRNA sequence.

EL623096; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL623096;
EST0602 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027B081, mRNA sequence.

EL623097; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL623097;
EST0603 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027B101, mRNA sequence.

EL623098; SV 1; linear; mRNA; EST; PLN; 378 BP.
EL623098;
EST0604 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027C011, mRNA sequence.

EL623099; SV 1; linear; mRNA; EST; PLN; 295 BP.
EL623099;
EST0605 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027C031, mRNA sequence.

EL623100; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL623100;
EST0606 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027C061, mRNA sequence.

EL623101; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL623101;
EST0607 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027C081, mRNA sequence.

EL623102; SV 1; linear; mRNA; EST; PLN; 374 BP.
EL623102;
EST0608 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027D091, mRNA sequence.

EL623103; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL623103;
EST0609 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027E041, mRNA sequence.

EL623104; SV 1; linear; mRNA; EST; PLN; 595 BP.
EL623104;
EST0610 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027E061, mRNA sequence.

EL623105; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL623105;
EST0611 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027F041, mRNA sequence.

EL623106; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL623106;
EST0612 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027F051, mRNA sequence.

EL623107; SV 1; linear; mRNA; EST; PLN; 661 BP.
EL623107;
EST0613 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027G041, mRNA sequence.

EL623108; SV 1; linear; mRNA; EST; PLN; 314 BP.
EL623108;
EST0614 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027G061, mRNA sequence.

EL623109; SV 1; linear; mRNA; EST; PLN; 743 BP.
EL623109;
EST0615 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027G111, mRNA sequence.

EL623110; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL623110;
EST0616 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027H081, mRNA sequence.

EL623111; SV 1; linear; mRNA; EST; PLN; 462 BP.
EL623111;
EST0617 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B027H091, mRNA sequence.

EL623112; SV 1; linear; mRNA; EST; PLN; 255 BP.
EL623112;
EST0618 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028A081, mRNA sequence.

EL623113; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL623113;
EST0619 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028A091, mRNA sequence.

EL623114; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL623114;
EST0620 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028A121, mRNA sequence.

EL623115; SV 1; linear; mRNA; EST; PLN; 213 BP.
EL623115;
EST0621 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028B051, mRNA sequence.

EL623116; SV 1; linear; mRNA; EST; PLN; 408 BP.
EL623116;
EST0622 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028B071, mRNA sequence.

EL623117; SV 1; linear; mRNA; EST; PLN; 451 BP.
EL623117;
EST0623 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028B121, mRNA sequence.

EL623118; SV 1; linear; mRNA; EST; PLN; 454 BP.
EL623118;
EST0624 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028C051, mRNA sequence.

EL623119; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL623119;
EST0625 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028C081, mRNA sequence.

EL623120; SV 1; linear; mRNA; EST; PLN; 334 BP.
EL623120;
EST0626 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028D011, mRNA sequence.

EL623121; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL623121;
EST0627 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028D091, mRNA sequence.

EL623122; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL623122;
EST0628 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028E031, mRNA sequence.

EL623123; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL623123;
EST0629 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028E051, mRNA sequence.

EL623124; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL623124;
EST0630 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028E101, mRNA sequence.

EL623125; SV 1; linear; mRNA; EST; PLN; 158 BP.
EL623125;
EST0631 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028F011, mRNA sequence.

EL623126; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL623126;
EST0632 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028F041, mRNA sequence.

EL623127; SV 1; linear; mRNA; EST; PLN; 241 BP.
EL623127;
EST0633 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028G021, mRNA sequence.

EL623128; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL623128;
EST0634 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028G041, mRNA sequence.

EL623129; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL623129;
EST0635 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028G081, mRNA sequence.

EL623130; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL623130;
EST0636 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028H041, mRNA sequence.

EL623131; SV 1; linear; mRNA; EST; PLN; 189 BP.
EL623131;
EST0637 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028H051, mRNA sequence.

EL623132; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL623132;
EST0638 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028H081, mRNA sequence.

EL623133; SV 1; linear; mRNA; EST; PLN; 606 BP.
EL623133;
EST0639 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028H101, mRNA sequence.

EL623134; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL623134;
EST0640 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028H111, mRNA sequence.

EL623135; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL623135;
EST0641 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B028H121, mRNA sequence.

EL623136; SV 1; linear; mRNA; EST; PLN; 447 BP.
EL623136;
EST0642 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029A081, mRNA sequence.

EL623137; SV 1; linear; mRNA; EST; PLN; 424 BP.
EL623137;
EST0643 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029A101, mRNA sequence.

EL623138; SV 1; linear; mRNA; EST; PLN; 379 BP.
EL623138;
EST0644 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029B011, mRNA sequence.

EL623139; SV 1; linear; mRNA; EST; PLN; 326 BP.
EL623139;
EST0645 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029B061, mRNA sequence.

EL623140; SV 1; linear; mRNA; EST; PLN; 246 BP.
EL623140;
EST0646 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029B071, mRNA sequence.

EL623141; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL623141;
EST0647 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029B101, mRNA sequence.

EL623142; SV 1; linear; mRNA; EST; PLN; 322 BP.
EL623142;
EST0648 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029C041, mRNA sequence.

EL623143; SV 1; linear; mRNA; EST; PLN; 180 BP.
EL623143;
EST0649 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029C051, mRNA sequence.

EL623144; SV 1; linear; mRNA; EST; PLN; 351 BP.
EL623144;
EST0650 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029C071, mRNA sequence.

EL623145; SV 1; linear; mRNA; EST; PLN; 331 BP.
EL623145;
EST0651 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029D031, mRNA sequence.

EL623146; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL623146;
EST0652 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029D061, mRNA sequence.

EL623147; SV 1; linear; mRNA; EST; PLN; 377 BP.
EL623147;
EST0653 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029D081, mRNA sequence.

EL623148; SV 1; linear; mRNA; EST; PLN; 336 BP.
EL623148;
EST0654 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029E041, mRNA sequence.

EL623149; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL623149;
EST0655 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029E061, mRNA sequence.

EL623150; SV 1; linear; mRNA; EST; PLN; 628 BP.
EL623150;
EST0656 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029E081, mRNA sequence.

EL623151; SV 1; linear; mRNA; EST; PLN; 339 BP.
EL623151;
EST0657 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029F111, mRNA sequence.

EL623152; SV 1; linear; mRNA; EST; PLN; 395 BP.
EL623152;
EST0658 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029G081, mRNA sequence.

EL623153; SV 1; linear; mRNA; EST; PLN; 391 BP.
EL623153;
EST0659 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029G091, mRNA sequence.

EL623154; SV 1; linear; mRNA; EST; PLN; 449 BP.
EL623154;
EST0660 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029H041, mRNA sequence.

EL623155; SV 1; linear; mRNA; EST; PLN; 236 BP.
EL623155;
EST0661 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029H061, mRNA sequence.

EL623156; SV 1; linear; mRNA; EST; PLN; 630 BP.
EL623156;
EST0662 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029H071, mRNA sequence.

EL623157; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL623157;
EST0663 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029H081, mRNA sequence.

EL623158; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL623158;
EST0664 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B029H101, mRNA sequence.

EL623159; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL623159;
EST0665 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030A101, mRNA sequence.

EL623160; SV 1; linear; mRNA; EST; PLN; 466 BP.
EL623160;
EST0666 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030B011, mRNA sequence.

EL623161; SV 1; linear; mRNA; EST; PLN; 393 BP.
EL623161;
EST0667 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030B031, mRNA sequence.

EL623162; SV 1; linear; mRNA; EST; PLN; 233 BP.
EL623162;
EST0668 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030B041, mRNA sequence.

EL623163; SV 1; linear; mRNA; EST; PLN; 441 BP.
EL623163;
EST0669 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030B101, mRNA sequence.

EL623164; SV 1; linear; mRNA; EST; PLN; 530 BP.
EL623164;
EST0670 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030D071, mRNA sequence.

EL623165; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL623165;
EST0671 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030D111, mRNA sequence.

EL623166; SV 1; linear; mRNA; EST; PLN; 414 BP.
EL623166;
EST0672 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030E091, mRNA sequence.

EL623167; SV 1; linear; mRNA; EST; PLN; 350 BP.
EL623167;
EST0673 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030E111, mRNA sequence.

EL623168; SV 1; linear; mRNA; EST; PLN; 329 BP.
EL623168;
EST0674 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030F031, mRNA sequence.

EL623169; SV 1; linear; mRNA; EST; PLN; 377 BP.
EL623169;
EST0675 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030F041, mRNA sequence.

EL623170; SV 1; linear; mRNA; EST; PLN; 436 BP.
EL623170;
EST0676 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030G011, mRNA sequence.

EL623171; SV 1; linear; mRNA; EST; PLN; 266 BP.
EL623171;
EST0677 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030G021, mRNA sequence.

EL623172; SV 1; linear; mRNA; EST; PLN; 406 BP.
EL623172;
EST0678 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030G031, mRNA sequence.

EL623173; SV 1; linear; mRNA; EST; PLN; 228 BP.
EL623173;
EST0679 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030G071, mRNA sequence.

EL623174; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL623174;
EST0680 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B030H101, mRNA sequence.

EL623175; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL623175;
EST0681 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031A011, mRNA sequence.

EL623176; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL623176;
EST0682 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031A031, mRNA sequence.

EL623177; SV 1; linear; mRNA; EST; PLN; 428 BP.
EL623177;
EST0683 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031B011, mRNA sequence.

EL623178; SV 1; linear; mRNA; EST; PLN; 305 BP.
EL623178;
EST0684 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031B041, mRNA sequence.

EL623179; SV 1; linear; mRNA; EST; PLN; 442 BP.
EL623179;
EST0685 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031B071, mRNA sequence.

EL623180; SV 1; linear; mRNA; EST; PLN; 373 BP.
EL623180;
EST0686 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031B111, mRNA sequence.

EL623181; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL623181;
EST0687 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031C041, mRNA sequence.

EL623182; SV 1; linear; mRNA; EST; PLN; 493 BP.
EL623182;
EST0688 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031C061, mRNA sequence.

EL623183; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL623183;
EST0689 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031C091, mRNA sequence.

EL623184; SV 1; linear; mRNA; EST; PLN; 210 BP.
EL623184;
EST0690 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031C101, mRNA sequence.

EL623185; SV 1; linear; mRNA; EST; PLN; 454 BP.
EL623185;
EST0691 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031D081, mRNA sequence.

EL623186; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL623186;
EST0692 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031D091, mRNA sequence.

EL623187; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL623187;
EST0693 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031E011, mRNA sequence.

EL623188; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL623188;
EST0694 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031F041, mRNA sequence.

EL623189; SV 1; linear; mRNA; EST; PLN; 381 BP.
EL623189;
EST0695 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031F091, mRNA sequence.

EL623190; SV 1; linear; mRNA; EST; PLN; 484 BP.
EL623190;
EST0696 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031F111, mRNA sequence.

EL623191; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL623191;
EST0697 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031G011, mRNA sequence.

EL623192; SV 1; linear; mRNA; EST; PLN; 437 BP.
EL623192;
EST0698 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031G041, mRNA sequence.

EL623193; SV 1; linear; mRNA; EST; PLN; 407 BP.
EL623193;
EST0699 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031H071, mRNA sequence.

EL623194; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL623194;
EST0700 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B031H081, mRNA sequence.

EL623195; SV 1; linear; mRNA; EST; PLN; 642 BP.
EL623195;
EST0701 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B032B021, mRNA sequence.

EL623196; SV 1; linear; mRNA; EST; PLN; 671 BP.
EL623196;
EST0702 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B032B061, mRNA sequence.

EL623197; SV 1; linear; mRNA; EST; PLN; 666 BP.
EL623197;
EST0703 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B032C031, mRNA sequence.

EL623198; SV 1; linear; mRNA; EST; PLN; 178 BP.
EL623198;
EST0704 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B032C101, mRNA sequence.

EL623199; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL623199;
EST0705 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B032D021, mRNA sequence.

EL623200; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL623200;
EST0706 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B032D031, mRNA sequence.

EL623201; SV 1; linear; mRNA; EST; PLN; 463 BP.
EL623201;
EST0707 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B032D101, mRNA sequence.

EL623202; SV 1; linear; mRNA; EST; PLN; 611 BP.
EL623202;
EST0708 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B032H111, mRNA sequence.

EL623203; SV 1; linear; mRNA; EST; PLN; 181 BP.
EL623203;
EST0709 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033A041, mRNA sequence.

EL623204; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL623204;
EST0710 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033A121, mRNA sequence.

EL623205; SV 1; linear; mRNA; EST; PLN; 191 BP.
EL623205;
EST0711 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033B041, mRNA sequence.

EL623206; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL623206;
EST0712 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033B091, mRNA sequence.

EL623207; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL623207;
EST0713 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033C081, mRNA sequence.

EL623208; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL623208;
EST0714 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033C111, mRNA sequence.

EL623209; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL623209;
EST0715 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033D031, mRNA sequence.

EL623210; SV 1; linear; mRNA; EST; PLN; 1171 BP.
EL623210;
EST0716 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033D051, mRNA sequence.

EL623211; SV 1; linear; mRNA; EST; PLN; 580 BP.
EL623211;
EST0717 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033D121, mRNA sequence.

EL623212; SV 1; linear; mRNA; EST; PLN; 384 BP.
EL623212;
EST0718 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033E031, mRNA sequence.

EL623213; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL623213;
EST0719 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033E091, mRNA sequence.

EL623214; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL623214;
EST0720 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033E101, mRNA sequence.

EL623215; SV 1; linear; mRNA; EST; PLN; 606 BP.
EL623215;
EST0721 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033F091, mRNA sequence.

EL623216; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL623216;
EST0722 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033F111, mRNA sequence.

EL623217; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL623217;
EST0723 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B033F121, mRNA sequence.

EL623218; SV 1; linear; mRNA; EST; PLN; 424 BP.
EL623218;
EST0724 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034A011, mRNA sequence.

EL623219; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623219;
EST0725 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034A031, mRNA sequence.

EL623220; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL623220;
EST0726 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034A041, mRNA sequence.

EL623221; SV 1; linear; mRNA; EST; PLN; 483 BP.
EL623221;
EST0727 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034A051, mRNA sequence.

EL623222; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL623222;
EST0728 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034A071, mRNA sequence.

EL623223; SV 1; linear; mRNA; EST; PLN; 468 BP.
EL623223;
EST0729 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034A101, mRNA sequence.

EL623224; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL623224;
EST0730 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034B011, mRNA sequence.

EL623225; SV 1; linear; mRNA; EST; PLN; 316 BP.
EL623225;
EST0731 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034B091, mRNA sequence.

EL623226; SV 1; linear; mRNA; EST; PLN; 502 BP.
EL623226;
EST0732 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034C021, mRNA sequence.

EL623227; SV 1; linear; mRNA; EST; PLN; 661 BP.
EL623227;
EST0733 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034D011, mRNA sequence.

EL623228; SV 1; linear; mRNA; EST; PLN; 480 BP.
EL623228;
EST0734 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034D071, mRNA sequence.

EL623229; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL623229;
EST0735 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034E061, mRNA sequence.

EL623230; SV 1; linear; mRNA; EST; PLN; 629 BP.
EL623230;
EST0736 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034E081, mRNA sequence.

EL623231; SV 1; linear; mRNA; EST; PLN; 405 BP.
EL623231;
EST0737 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034E091, mRNA sequence.

EL623232; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL623232;
EST0738 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034F031, mRNA sequence.

EL623233; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL623233;
EST0739 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034F071, mRNA sequence.

EL623234; SV 1; linear; mRNA; EST; PLN; 334 BP.
EL623234;
EST0740 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034F121, mRNA sequence.

EL623235; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL623235;
EST0741 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034G011, mRNA sequence.

EL623236; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL623236;
EST0742 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034G021, mRNA sequence.

EL623237; SV 1; linear; mRNA; EST; PLN; 676 BP.
EL623237;
EST0743 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034G061, mRNA sequence.

EL623238; SV 1; linear; mRNA; EST; PLN; 716 BP.
EL623238;
EST0744 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034H021, mRNA sequence.

EL623239; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL623239;
EST0745 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034H031, mRNA sequence.

EL623240; SV 1; linear; mRNA; EST; PLN; 662 BP.
EL623240;
EST0746 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034H041, mRNA sequence.

EL623241; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL623241;
EST0747 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B034H051, mRNA sequence.

EL623242; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL623242;
EST0748 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035A111, mRNA sequence.

EL623243; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL623243;
EST0749 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035A121, mRNA sequence.

EL623244; SV 1; linear; mRNA; EST; PLN; 361 BP.
EL623244;
EST0750 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035B031, mRNA sequence.

EL623245; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL623245;
EST0751 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035B051, mRNA sequence.

EL623246; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL623246;
EST0752 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035B061, mRNA sequence.

EL623247; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL623247;
EST0753 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035B081, mRNA sequence.

EL623248; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL623248;
EST0754 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035B091, mRNA sequence.

EL623249; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL623249;
EST0755 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035B101, mRNA sequence.

EL623250; SV 1; linear; mRNA; EST; PLN; 401 BP.
EL623250;
EST0756 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035C021, mRNA sequence.

EL623251; SV 1; linear; mRNA; EST; PLN; 374 BP.
EL623251;
EST0757 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035C031, mRNA sequence.

EL623252; SV 1; linear; mRNA; EST; PLN; 384 BP.
EL623252;
EST0758 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035C041, mRNA sequence.

EL623253; SV 1; linear; mRNA; EST; PLN; 191 BP.
EL623253;
EST0759 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035C091, mRNA sequence.

EL623254; SV 1; linear; mRNA; EST; PLN; 386 BP.
EL623254;
EST0760 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035E031, mRNA sequence.

EL623255; SV 1; linear; mRNA; EST; PLN; 568 BP.
EL623255;
EST0761 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035E061, mRNA sequence.

EL623256; SV 1; linear; mRNA; EST; PLN; 615 BP.
EL623256;
EST0762 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035E081, mRNA sequence.

EL623257; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL623257;
EST0763 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035E111, mRNA sequence.

EL623258; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL623258;
EST0764 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035E121, mRNA sequence.

EL623259; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL623259;
EST0765 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035F011, mRNA sequence.

EL623260; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL623260;
EST0766 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035F021, mRNA sequence.

EL623261; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL623261;
EST0767 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035F041, mRNA sequence.

EL623262; SV 1; linear; mRNA; EST; PLN; 424 BP.
EL623262;
EST0768 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035F071, mRNA sequence.

EL623263; SV 1; linear; mRNA; EST; PLN; 398 BP.
EL623263;
EST0769 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035F091, mRNA sequence.

EL623264; SV 1; linear; mRNA; EST; PLN; 801 BP.
EL623264;
EST0770 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035G021, mRNA sequence.

EL623265; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL623265;
EST0771 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035G061, mRNA sequence.

EL623266; SV 1; linear; mRNA; EST; PLN; 393 BP.
EL623266;
EST0772 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035G091, mRNA sequence.

EL623267; SV 1; linear; mRNA; EST; PLN; 603 BP.
EL623267;
EST0773 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035H081, mRNA sequence.

EL623268; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL623268;
EST0774 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B035H091, mRNA sequence.

EL623269; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL623269;
EST0775 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036A011, mRNA sequence.

EL623270; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL623270;
EST0776 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036A071, mRNA sequence.

EL623271; SV 1; linear; mRNA; EST; PLN; 463 BP.
EL623271;
EST0777 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036A101, mRNA sequence.

EL623272; SV 1; linear; mRNA; EST; PLN; 280 BP.
EL623272;
EST0778 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036A111, mRNA sequence.

EL623273; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL623273;
EST0779 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036B011, mRNA sequence.

EL623274; SV 1; linear; mRNA; EST; PLN; 432 BP.
EL623274;
EST0780 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036B021, mRNA sequence.

EL623275; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL623275;
EST0781 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036B031, mRNA sequence.

EL623276; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL623276;
EST0782 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036B081, mRNA sequence.

EL623277; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL623277;
EST0783 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036C021, mRNA sequence.

EL623278; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL623278;
EST0784 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036C051, mRNA sequence.

EL623279; SV 1; linear; mRNA; EST; PLN; 249 BP.
EL623279;
EST0785 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036C091, mRNA sequence.

EL623280; SV 1; linear; mRNA; EST; PLN; 436 BP.
EL623280;
EST0786 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036C111, mRNA sequence.

EL623281; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL623281;
EST0787 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036D021, mRNA sequence.

EL623282; SV 1; linear; mRNA; EST; PLN; 440 BP.
EL623282;
EST0788 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036D031, mRNA sequence.

EL623283; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL623283;
EST0789 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036D081, mRNA sequence.

EL623284; SV 1; linear; mRNA; EST; PLN; 503 BP.
EL623284;
EST0790 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036E081, mRNA sequence.

EL623285; SV 1; linear; mRNA; EST; PLN; 490 BP.
EL623285;
EST0791 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036E121, mRNA sequence.

EL623286; SV 1; linear; mRNA; EST; PLN; 430 BP.
EL623286;
EST0792 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036F031, mRNA sequence.

EL623287; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL623287;
EST0793 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036F071, mRNA sequence.

EL623288; SV 1; linear; mRNA; EST; PLN; 441 BP.
EL623288;
EST0794 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036G051, mRNA sequence.

EL623289; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL623289;
EST0795 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036G091, mRNA sequence.

EL623290; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL623290;
EST0796 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036G111, mRNA sequence.

EL623291; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL623291;
EST0797 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036H071, mRNA sequence.

EL623292; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL623292;
EST0798 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B036H091, mRNA sequence.

EL623293; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL623293;
EST0799 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037A011, mRNA sequence.

EL623294; SV 1; linear; mRNA; EST; PLN; 764 BP.
EL623294;
EST0800 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037A041, mRNA sequence.

EL623295; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL623295;
EST0801 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037A121, mRNA sequence.

EL623296; SV 1; linear; mRNA; EST; PLN; 716 BP.
EL623296;
EST0802 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037B091, mRNA sequence.

EL623297; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL623297;
EST0803 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037B111, mRNA sequence.

EL623298; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL623298;
EST0804 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037C061, mRNA sequence.

EL623299; SV 1; linear; mRNA; EST; PLN; 723 BP.
EL623299;
EST0805 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037C071, mRNA sequence.

EL623300; SV 1; linear; mRNA; EST; PLN; 668 BP.
EL623300;
EST0806 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037C101, mRNA sequence.

EL623301; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL623301;
EST0807 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037D011, mRNA sequence.

EL623302; SV 1; linear; mRNA; EST; PLN; 723 BP.
EL623302;
EST0808 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037D081, mRNA sequence.

EL623303; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL623303;
EST0809 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037D111, mRNA sequence.

EL623304; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL623304;
EST0810 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037E081, mRNA sequence.

EL623305; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL623305;
EST0811 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037E091, mRNA sequence.

EL623306; SV 1; linear; mRNA; EST; PLN; 728 BP.
EL623306;
EST0812 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037F021, mRNA sequence.

EL623307; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL623307;
EST0813 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037F051, mRNA sequence.

EL623308; SV 1; linear; mRNA; EST; PLN; 721 BP.
EL623308;
EST0814 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037F071, mRNA sequence.

EL623309; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL623309;
EST0815 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037F091, mRNA sequence.

EL623310; SV 1; linear; mRNA; EST; PLN; 335 BP.
EL623310;
EST0816 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037G041, mRNA sequence.

EL623311; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL623311;
EST0817 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037G061, mRNA sequence.

EL623312; SV 1; linear; mRNA; EST; PLN; 764 BP.
EL623312;
EST0818 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037G071, mRNA sequence.

EL623313; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL623313;
EST0819 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037H021, mRNA sequence.

EL623314; SV 1; linear; mRNA; EST; PLN; 618 BP.
EL623314;
EST0820 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037H081, mRNA sequence.

EL623315; SV 1; linear; mRNA; EST; PLN; 395 BP.
EL623315;
EST0821 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B037H091, mRNA sequence.

EL623316; SV 1; linear; mRNA; EST; PLN; 371 BP.
EL623316;
EST0822 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038A021, mRNA sequence.

EL623317; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL623317;
EST0823 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038A091, mRNA sequence.

EL623318; SV 1; linear; mRNA; EST; PLN; 503 BP.
EL623318;
EST0824 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038A121, mRNA sequence.

EL623319; SV 1; linear; mRNA; EST; PLN; 455 BP.
EL623319;
EST0825 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038C031, mRNA sequence.

EL623320; SV 1; linear; mRNA; EST; PLN; 436 BP.
EL623320;
EST0826 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038D061, mRNA sequence.

EL623321; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL623321;
EST0827 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038D081, mRNA sequence.

EL623322; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL623322;
EST0828 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038D091, mRNA sequence.

EL623323; SV 1; linear; mRNA; EST; PLN; 377 BP.
EL623323;
EST0829 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038D101, mRNA sequence.

EL623324; SV 1; linear; mRNA; EST; PLN; 374 BP.
EL623324;
EST0830 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038E071, mRNA sequence.

EL623325; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL623325;
EST0831 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038E121, mRNA sequence.

EL623326; SV 1; linear; mRNA; EST; PLN; 352 BP.
EL623326;
EST0832 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038F011, mRNA sequence.

EL623327; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL623327;
EST0833 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038F031, mRNA sequence.

EL623328; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL623328;
EST0834 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038F041, mRNA sequence.

EL623329; SV 1; linear; mRNA; EST; PLN; 387 BP.
EL623329;
EST0835 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038F061, mRNA sequence.

EL623330; SV 1; linear; mRNA; EST; PLN; 394 BP.
EL623330;
EST0836 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038F081, mRNA sequence.

EL623331; SV 1; linear; mRNA; EST; PLN; 426 BP.
EL623331;
EST0837 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038G021, mRNA sequence.

EL623332; SV 1; linear; mRNA; EST; PLN; 484 BP.
EL623332;
EST0838 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038G051, mRNA sequence.

EL623333; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL623333;
EST0839 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038H061, mRNA sequence.

EL623334; SV 1; linear; mRNA; EST; PLN; 468 BP.
EL623334;
EST0840 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038H071, mRNA sequence.

EL623335; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL623335;
EST0841 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B038H101, mRNA sequence.

EL623336; SV 1; linear; mRNA; EST; PLN; 362 BP.
EL623336;
EST0842 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039A121, mRNA sequence.

EL623337; SV 1; linear; mRNA; EST; PLN; 739 BP.
EL623337;
EST0843 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039B081, mRNA sequence.

EL623338; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL623338;
EST0844 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039B111, mRNA sequence.

EL623339; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL623339;
EST0845 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039C011, mRNA sequence.

EL623340; SV 1; linear; mRNA; EST; PLN; 409 BP.
EL623340;
EST0846 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039C031, mRNA sequence.

EL623341; SV 1; linear; mRNA; EST; PLN; 407 BP.
EL623341;
EST0847 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039C051, mRNA sequence.

EL623342; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL623342;
EST0848 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039C071, mRNA sequence.

EL623343; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL623343;
EST0849 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039C081, mRNA sequence.

EL623344; SV 1; linear; mRNA; EST; PLN; 472 BP.
EL623344;
EST0850 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039C091, mRNA sequence.

EL623345; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL623345;
EST0851 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039D081, mRNA sequence.

EL623346; SV 1; linear; mRNA; EST; PLN; 436 BP.
EL623346;
EST0852 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039D121, mRNA sequence.

EL623347; SV 1; linear; mRNA; EST; PLN; 398 BP.
EL623347;
EST0853 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039E031, mRNA sequence.

EL623348; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL623348;
EST0854 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039E051, mRNA sequence.

EL623349; SV 1; linear; mRNA; EST; PLN; 646 BP.
EL623349;
EST0855 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039E071, mRNA sequence.

EL623350; SV 1; linear; mRNA; EST; PLN; 677 BP.
EL623350;
EST0856 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039E081, mRNA sequence.

EL623351; SV 1; linear; mRNA; EST; PLN; 399 BP.
EL623351;
EST0857 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039F031, mRNA sequence.

EL623352; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL623352;
EST0858 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039F091, mRNA sequence.

EL623353; SV 1; linear; mRNA; EST; PLN; 444 BP.
EL623353;
EST0859 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039F101, mRNA sequence.

EL623354; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL623354;
EST0860 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039G061, mRNA sequence.

EL623355; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL623355;
EST0861 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039G091, mRNA sequence.

EL623356; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL623356;
EST0862 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039G101, mRNA sequence.

EL623357; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL623357;
EST0863 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039G121, mRNA sequence.

EL623358; SV 1; linear; mRNA; EST; PLN; 286 BP.
EL623358;
EST0864 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039H031, mRNA sequence.

EL623359; SV 1; linear; mRNA; EST; PLN; 433 BP.
EL623359;
EST0865 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039H061, mRNA sequence.

EL623360; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL623360;
EST0866 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B039H101, mRNA sequence.

EL623361; SV 1; linear; mRNA; EST; PLN; 248 BP.
EL623361;
EST0867 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040A081, mRNA sequence.

EL623362; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL623362;
EST0868 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040B051, mRNA sequence.

EL623363; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL623363;
EST0869 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040C011, mRNA sequence.

EL623364; SV 1; linear; mRNA; EST; PLN; 413 BP.
EL623364;
EST0870 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040C041, mRNA sequence.

EL623365; SV 1; linear; mRNA; EST; PLN; 451 BP.
EL623365;
EST0871 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040D011, mRNA sequence.

EL623366; SV 1; linear; mRNA; EST; PLN; 495 BP.
EL623366;
EST0872 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040D071, mRNA sequence.

EL623367; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL623367;
EST0873 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040E021, mRNA sequence.

EL623368; SV 1; linear; mRNA; EST; PLN; 307 BP.
EL623368;
EST0874 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040E041, mRNA sequence.

EL623369; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL623369;
EST0875 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040E091, mRNA sequence.

EL623370; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL623370;
EST0876 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040E121, mRNA sequence.

EL623371; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL623371;
EST0877 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040F061, mRNA sequence.

EL623372; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL623372;
EST0878 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040F071, mRNA sequence.

EL623373; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL623373;
EST0879 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040F091, mRNA sequence.

EL623374; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL623374;
EST0880 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040F121, mRNA sequence.

EL623375; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL623375;
EST0881 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040G021, mRNA sequence.

EL623376; SV 1; linear; mRNA; EST; PLN; 366 BP.
EL623376;
EST0882 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040G031, mRNA sequence.

EL623377; SV 1; linear; mRNA; EST; PLN; 396 BP.
EL623377;
EST0883 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040G041, mRNA sequence.

EL623378; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL623378;
EST0884 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040G061, mRNA sequence.

EL623379; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL623379;
EST0885 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040G101, mRNA sequence.

EL623380; SV 1; linear; mRNA; EST; PLN; 432 BP.
EL623380;
EST0886 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040G121, mRNA sequence.

EL623381; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL623381;
EST0887 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040H051, mRNA sequence.

EL623382; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL623382;
EST0888 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B040H111, mRNA sequence.

EL623383; SV 1; linear; mRNA; EST; PLN; 567 BP.
EL623383;
EST0889 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041A021, mRNA sequence.

EL623384; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL623384;
EST0890 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041A041, mRNA sequence.

EL623385; SV 1; linear; mRNA; EST; PLN; 791 BP.
EL623385;
EST0891 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041A081, mRNA sequence.

EL623386; SV 1; linear; mRNA; EST; PLN; 751 BP.
EL623386;
EST0892 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041B021, mRNA sequence.

EL623387; SV 1; linear; mRNA; EST; PLN; 827 BP.
EL623387;
EST0893 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041B061, mRNA sequence.

EL623388; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL623388;
EST0894 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041B081, mRNA sequence.

EL623389; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL623389;
EST0895 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041B091, mRNA sequence.

EL623390; SV 1; linear; mRNA; EST; PLN; 243 BP.
EL623390;
EST0896 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041B111, mRNA sequence.

EL623391; SV 1; linear; mRNA; EST; PLN; 783 BP.
EL623391;
EST0897 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041C071, mRNA sequence.

EL623392; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL623392;
EST0898 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041C101, mRNA sequence.

EL623393; SV 1; linear; mRNA; EST; PLN; 423 BP.
EL623393;
EST0899 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041C111, mRNA sequence.

EL623394; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL623394;
EST0900 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041D081, mRNA sequence.

EL623395; SV 1; linear; mRNA; EST; PLN; 735 BP.
EL623395;
EST0901 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041D091, mRNA sequence.

EL623396; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL623396;
EST0902 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041E021, mRNA sequence.

EL623397; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL623397;
EST0903 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041F011, mRNA sequence.

EL623398; SV 1; linear; mRNA; EST; PLN; 731 BP.
EL623398;
EST0904 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041F051, mRNA sequence.

EL623399; SV 1; linear; mRNA; EST; PLN; 818 BP.
EL623399;
EST0905 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041F061, mRNA sequence.

EL623400; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL623400;
EST0906 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041F091, mRNA sequence.

EL623401; SV 1; linear; mRNA; EST; PLN; 818 BP.
EL623401;
EST0907 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041G091, mRNA sequence.

EL623402; SV 1; linear; mRNA; EST; PLN; 802 BP.
EL623402;
EST0908 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041G101, mRNA sequence.

EL623403; SV 1; linear; mRNA; EST; PLN; 396 BP.
EL623403;
EST0909 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041G121, mRNA sequence.

EL623404; SV 1; linear; mRNA; EST; PLN; 517 BP.
EL623404;
EST0910 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041H081, mRNA sequence.

EL623405; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL623405;
EST0911 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041H101, mRNA sequence.

EL623406; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL623406;
EST0912 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B041H121, mRNA sequence.

EL623407; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL623407;
EST0913 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042A051, mRNA sequence.

EL623408; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL623408;
EST0914 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042A071, mRNA sequence.

EL623409; SV 1; linear; mRNA; EST; PLN; 602 BP.
EL623409;
EST0915 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042C011, mRNA sequence.

EL623410; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL623410;
EST0916 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042C021, mRNA sequence.

EL623411; SV 1; linear; mRNA; EST; PLN; 534 BP.
EL623411;
EST0917 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042C041, mRNA sequence.

EL623412; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL623412;
EST0918 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042C051, mRNA sequence.

EL623413; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL623413;
EST0919 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042C061, mRNA sequence.

EL623414; SV 1; linear; mRNA; EST; PLN; 604 BP.
EL623414;
EST0920 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042D011, mRNA sequence.

EL623415; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL623415;
EST0921 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042D061, mRNA sequence.

EL623416; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL623416;
EST0922 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042E031, mRNA sequence.

EL623417; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL623417;
EST0923 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042F011, mRNA sequence.

EL623418; SV 1; linear; mRNA; EST; PLN; 550 BP.
EL623418;
EST0924 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042F121, mRNA sequence.

EL623419; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL623419;
EST0925 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042G051, mRNA sequence.

EL623420; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL623420;
EST0926 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042H011, mRNA sequence.

EL623421; SV 1; linear; mRNA; EST; PLN; 631 BP.
EL623421;
EST0927 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042H041, mRNA sequence.

EL623422; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL623422;
EST0928 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042H051, mRNA sequence.

EL623423; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL623423;
EST0929 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042H111, mRNA sequence.

EL623424; SV 1; linear; mRNA; EST; PLN; 452 BP.
EL623424;
EST0930 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B042H121, mRNA sequence.

EL623425; SV 1; linear; mRNA; EST; PLN; 167 BP.
EL623425;
EST0931 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043A021, mRNA sequence.

EL623426; SV 1; linear; mRNA; EST; PLN; 824 BP.
EL623426;
EST0932 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043A081, mRNA sequence.

EL623427; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL623427;
EST0933 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043B031, mRNA sequence.

EL623428; SV 1; linear; mRNA; EST; PLN; 810 BP.
EL623428;
EST0934 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043B071, mRNA sequence.

EL623429; SV 1; linear; mRNA; EST; PLN; 530 BP.
EL623429;
EST0935 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043B111, mRNA sequence.

EL623430; SV 1; linear; mRNA; EST; PLN; 724 BP.
EL623430;
EST0936 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043B121, mRNA sequence.

EL623431; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL623431;
EST0937 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043D011, mRNA sequence.

EL623432; SV 1; linear; mRNA; EST; PLN; 776 BP.
EL623432;
EST0938 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043D051, mRNA sequence.

EL623433; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL623433;
EST0939 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043D061, mRNA sequence.

EL623434; SV 1; linear; mRNA; EST; PLN; 353 BP.
EL623434;
EST0940 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043D091, mRNA sequence.

EL623435; SV 1; linear; mRNA; EST; PLN; 411 BP.
EL623435;
EST0941 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043F011, mRNA sequence.

EL623436; SV 1; linear; mRNA; EST; PLN; 465 BP.
EL623436;
EST0942 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043H031, mRNA sequence.

EL623437; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL623437;
EST0943 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B043H121, mRNA sequence.

EL623438; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL623438;
EST0944 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044A061, mRNA sequence.

EL623439; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL623439;
EST0945 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044A071, mRNA sequence.

EL623440; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL623440;
EST0946 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044A091, mRNA sequence.

EL623441; SV 1; linear; mRNA; EST; PLN; 406 BP.
EL623441;
EST0947 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044A101, mRNA sequence.

EL623442; SV 1; linear; mRNA; EST; PLN; 413 BP.
EL623442;
EST0948 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044B031, mRNA sequence.

EL623443; SV 1; linear; mRNA; EST; PLN; 791 BP.
EL623443;
EST0949 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044B051, mRNA sequence.

EL623444; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL623444;
EST0950 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044B091, mRNA sequence.

EL623445; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL623445;
EST0951 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044C041, mRNA sequence.

EL623446; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL623446;
EST0952 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044C051, mRNA sequence.

EL623447; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL623447;
EST0953 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044C111, mRNA sequence.

EL623448; SV 1; linear; mRNA; EST; PLN; 439 BP.
EL623448;
EST0954 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044E041, mRNA sequence.

EL623449; SV 1; linear; mRNA; EST; PLN; 652 BP.
EL623449;
EST0955 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044E061, mRNA sequence.

EL623450; SV 1; linear; mRNA; EST; PLN; 408 BP.
EL623450;
EST0956 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044E081, mRNA sequence.

EL623451; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL623451;
EST0957 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044E091, mRNA sequence.

EL623452; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL623452;
EST0958 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044F021, mRNA sequence.

EL623453; SV 1; linear; mRNA; EST; PLN; 778 BP.
EL623453;
EST0959 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044G051, mRNA sequence.

EL623454; SV 1; linear; mRNA; EST; PLN; 810 BP.
EL623454;
EST0960 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044G061, mRNA sequence.

EL623455; SV 1; linear; mRNA; EST; PLN; 809 BP.
EL623455;
EST0961 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044G101, mRNA sequence.

EL623456; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL623456;
EST0962 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B044G111, mRNA sequence.

EL623457; SV 1; linear; mRNA; EST; PLN; 637 BP.
EL623457;
EST0963 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045A011, mRNA sequence.

EL623458; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL623458;
EST0964 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045A021, mRNA sequence.

EL623459; SV 1; linear; mRNA; EST; PLN; 721 BP.
EL623459;
EST0965 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045A051, mRNA sequence.

EL623460; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL623460;
EST0966 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045A061, mRNA sequence.

EL623461; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL623461;
EST0967 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045A091, mRNA sequence.

EL623462; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL623462;
EST0968 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045A111, mRNA sequence.

EL623463; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL623463;
EST0969 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045A121, mRNA sequence.

EL623464; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL623464;
EST0970 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045B051, mRNA sequence.

EL623465; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL623465;
EST0971 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045B101, mRNA sequence.

EL623466; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL623466;
EST0972 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045C031, mRNA sequence.

EL623467; SV 1; linear; mRNA; EST; PLN; 723 BP.
EL623467;
EST0973 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045C101, mRNA sequence.

EL623468; SV 1; linear; mRNA; EST; PLN; 782 BP.
EL623468;
EST0974 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045C111, mRNA sequence.

EL623469; SV 1; linear; mRNA; EST; PLN; 670 BP.
EL623469;
EST0975 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045D081, mRNA sequence.

EL623470; SV 1; linear; mRNA; EST; PLN; 824 BP.
EL623470;
EST0976 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045D101, mRNA sequence.

EL623471; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL623471;
EST0977 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045E021, mRNA sequence.

EL623472; SV 1; linear; mRNA; EST; PLN; 769 BP.
EL623472;
EST0978 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045E041, mRNA sequence.

EL623473; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL623473;
EST0979 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045E071, mRNA sequence.

EL623474; SV 1; linear; mRNA; EST; PLN; 650 BP.
EL623474;
EST0980 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045F031, mRNA sequence.

EL623475; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL623475;
EST0981 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045F061, mRNA sequence.

EL623476; SV 1; linear; mRNA; EST; PLN; 786 BP.
EL623476;
EST0982 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045F071, mRNA sequence.

EL623477; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL623477;
EST0983 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045F081, mRNA sequence.

EL623478; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL623478;
EST0984 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045G021, mRNA sequence.

EL623479; SV 1; linear; mRNA; EST; PLN; 655 BP.
EL623479;
EST0985 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045G031, mRNA sequence.

EL623480; SV 1; linear; mRNA; EST; PLN; 774 BP.
EL623480;
EST0986 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045G041, mRNA sequence.

EL623481; SV 1; linear; mRNA; EST; PLN; 848 BP.
EL623481;
EST0987 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045H051, mRNA sequence.

EL623482; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL623482;
EST0988 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045H081, mRNA sequence.

EL623483; SV 1; linear; mRNA; EST; PLN; 783 BP.
EL623483;
EST0989 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045H091, mRNA sequence.

EL623484; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL623484;
EST0990 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B045H111, mRNA sequence.

EL623485; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL623485;
EST0991 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046A081, mRNA sequence.

EL623486; SV 1; linear; mRNA; EST; PLN; 838 BP.
EL623486;
EST0992 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046A121, mRNA sequence.

EL623487; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL623487;
EST0993 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046B021, mRNA sequence.

EL623488; SV 1; linear; mRNA; EST; PLN; 823 BP.
EL623488;
EST0994 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046B071, mRNA sequence.

EL623489; SV 1; linear; mRNA; EST; PLN; 874 BP.
EL623489;
EST0995 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046B101, mRNA sequence.

EL623490; SV 1; linear; mRNA; EST; PLN; 649 BP.
EL623490;
EST0996 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046C031, mRNA sequence.

EL623491; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL623491;
EST0997 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046C051, mRNA sequence.

EL623492; SV 1; linear; mRNA; EST; PLN; 891 BP.
EL623492;
EST0998 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046C061, mRNA sequence.

EL623493; SV 1; linear; mRNA; EST; PLN; 758 BP.
EL623493;
EST0999 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046D011, mRNA sequence.

EL623494; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL623494;
EST1000 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046E011, mRNA sequence.

EL623495; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL623495;
EST1001 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046E051, mRNA sequence.

EL623496; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL623496;
EST1002 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046E091, mRNA sequence.

EL623497; SV 1; linear; mRNA; EST; PLN; 860 BP.
EL623497;
EST1003 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046E101, mRNA sequence.

EL623498; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL623498;
EST1004 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046F031, mRNA sequence.

EL623499; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL623499;
EST1005 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046F051, mRNA sequence.

EL623500; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL623500;
EST1006 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046G021, mRNA sequence.

EL623501; SV 1; linear; mRNA; EST; PLN; 824 BP.
EL623501;
EST1007 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046G071, mRNA sequence.

EL623502; SV 1; linear; mRNA; EST; PLN; 830 BP.
EL623502;
EST1008 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046G101, mRNA sequence.

EL623503; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL623503;
EST1009 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046H021, mRNA sequence.

EL623504; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL623504;
EST1010 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046H041, mRNA sequence.

EL623505; SV 1; linear; mRNA; EST; PLN; 833 BP.
EL623505;
EST1011 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046H051, mRNA sequence.

EL623506; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL623506;
EST1012 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046H061, mRNA sequence.

EL623507; SV 1; linear; mRNA; EST; PLN; 769 BP.
EL623507;
EST1013 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B046H121, mRNA sequence.

EL623508; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL623508;
EST1014 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047A021, mRNA sequence.

EL623509; SV 1; linear; mRNA; EST; PLN; 471 BP.
EL623509;
EST1015 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047A061, mRNA sequence.

EL623510; SV 1; linear; mRNA; EST; PLN; 620 BP.
EL623510;
EST1016 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047A101, mRNA sequence.

EL623511; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL623511;
EST1017 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047B011, mRNA sequence.

EL623512; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL623512;
EST1018 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047B021, mRNA sequence.

EL623513; SV 1; linear; mRNA; EST; PLN; 708 BP.
EL623513;
EST1019 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047B091, mRNA sequence.

EL623514; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL623514;
EST1020 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047B101, mRNA sequence.

EL623515; SV 1; linear; mRNA; EST; PLN; 454 BP.
EL623515;
EST1021 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047C011, mRNA sequence.

EL623516; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL623516;
EST1022 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047C081, mRNA sequence.

EL623517; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL623517;
EST1023 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047C101, mRNA sequence.

EL623518; SV 1; linear; mRNA; EST; PLN; 533 BP.
EL623518;
EST1024 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047D111, mRNA sequence.

EL623519; SV 1; linear; mRNA; EST; PLN; 442 BP.
EL623519;
EST1025 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047E031, mRNA sequence.

EL623520; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL623520;
EST1026 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047E051, mRNA sequence.

EL623521; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL623521;
EST1027 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047E081, mRNA sequence.

EL623522; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL623522;
EST1028 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047E121, mRNA sequence.

EL623523; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL623523;
EST1029 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047F021, mRNA sequence.

EL623524; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL623524;
EST1030 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047F041, mRNA sequence.

EL623525; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL623525;
EST1031 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047F071, mRNA sequence.

EL623526; SV 1; linear; mRNA; EST; PLN; 668 BP.
EL623526;
EST1032 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047F091, mRNA sequence.

EL623527; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL623527;
EST1033 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047F101, mRNA sequence.

EL623528; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL623528;
EST1034 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047F121, mRNA sequence.

EL623529; SV 1; linear; mRNA; EST; PLN; 533 BP.
EL623529;
EST1035 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047G011, mRNA sequence.

EL623530; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL623530;
EST1036 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047G021, mRNA sequence.

EL623531; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL623531;
EST1037 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047G031, mRNA sequence.

EL623532; SV 1; linear; mRNA; EST; PLN; 665 BP.
EL623532;
EST1038 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047G041, mRNA sequence.

EL623533; SV 1; linear; mRNA; EST; PLN; 443 BP.
EL623533;
EST1039 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047G051, mRNA sequence.

EL623534; SV 1; linear; mRNA; EST; PLN; 654 BP.
EL623534;
EST1040 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047G091, mRNA sequence.

EL623535; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL623535;
EST1041 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047G111, mRNA sequence.

EL623536; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL623536;
EST1042 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047G121, mRNA sequence.

EL623537; SV 1; linear; mRNA; EST; PLN; 394 BP.
EL623537;
EST1043 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047H011, mRNA sequence.

EL623538; SV 1; linear; mRNA; EST; PLN; 359 BP.
EL623538;
EST1044 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047H021, mRNA sequence.

EL623539; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL623539;
EST1045 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047H051, mRNA sequence.

EL623540; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL623540;
EST1046 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047H061, mRNA sequence.

EL623541; SV 1; linear; mRNA; EST; PLN; 628 BP.
EL623541;
EST1047 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047H071, mRNA sequence.

EL623542; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL623542;
EST1048 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047H091, mRNA sequence.

EL623543; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL623543;
EST1049 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047H101, mRNA sequence.

EL623544; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL623544;
EST1050 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B047H111, mRNA sequence.

EL623545; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL623545;
EST1051 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048A051, mRNA sequence.

EL623546; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623546;
EST1052 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048B091, mRNA sequence.

EL623547; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL623547;
EST1053 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048C011, mRNA sequence.

EL623548; SV 1; linear; mRNA; EST; PLN; 770 BP.
EL623548;
EST1054 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048D021, mRNA sequence.

EL623549; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL623549;
EST1055 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048D071, mRNA sequence.

EL623550; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL623550;
EST1056 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048D101, mRNA sequence.

EL623551; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL623551;
EST1057 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048D111, mRNA sequence.

EL623552; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL623552;
EST1058 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048E031, mRNA sequence.

EL623553; SV 1; linear; mRNA; EST; PLN; 875 BP.
EL623553;
EST1059 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048E071, mRNA sequence.

EL623554; SV 1; linear; mRNA; EST; PLN; 830 BP.
EL623554;
EST1060 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048E111, mRNA sequence.

EL623555; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL623555;
EST1061 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048F021, mRNA sequence.

EL623556; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL623556;
EST1062 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048F031, mRNA sequence.

EL623557; SV 1; linear; mRNA; EST; PLN; 839 BP.
EL623557;
EST1063 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048F061, mRNA sequence.

EL623558; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL623558;
EST1064 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048F091, mRNA sequence.

EL623559; SV 1; linear; mRNA; EST; PLN; 604 BP.
EL623559;
EST1065 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048G021, mRNA sequence.

EL623560; SV 1; linear; mRNA; EST; PLN; 817 BP.
EL623560;
EST1066 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048G031, mRNA sequence.

EL623561; SV 1; linear; mRNA; EST; PLN; 874 BP.
EL623561;
EST1067 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048G081, mRNA sequence.

EL623562; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL623562;
EST1068 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048G101, mRNA sequence.

EL623563; SV 1; linear; mRNA; EST; PLN; 861 BP.
EL623563;
EST1069 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048H031, mRNA sequence.

EL623564; SV 1; linear; mRNA; EST; PLN; 817 BP.
EL623564;
EST1070 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048H081, mRNA sequence.

EL623565; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL623565;
EST1071 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B048H111, mRNA sequence.

EL623566; SV 1; linear; mRNA; EST; PLN; 403 BP.
EL623566;
EST1072 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049A011, mRNA sequence.

EL623567; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL623567;
EST1073 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049A051, mRNA sequence.

EL623568; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL623568;
EST1074 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049A121, mRNA sequence.

EL623569; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL623569;
EST1075 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049B061, mRNA sequence.

EL623570; SV 1; linear; mRNA; EST; PLN; 630 BP.
EL623570;
EST1076 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049B071, mRNA sequence.

EL623571; SV 1; linear; mRNA; EST; PLN; 456 BP.
EL623571;
EST1077 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049C021, mRNA sequence.

EL623572; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL623572;
EST1078 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049C031, mRNA sequence.

EL623573; SV 1; linear; mRNA; EST; PLN; 450 BP.
EL623573;
EST1079 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049C051, mRNA sequence.

EL623574; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL623574;
EST1080 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049C071, mRNA sequence.

EL623575; SV 1; linear; mRNA; EST; PLN; 628 BP.
EL623575;
EST1081 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049C081, mRNA sequence.

EL623576; SV 1; linear; mRNA; EST; PLN; 630 BP.
EL623576;
EST1082 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049C111, mRNA sequence.

EL623577; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL623577;
EST1083 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049D011, mRNA sequence.

EL623578; SV 1; linear; mRNA; EST; PLN; 666 BP.
EL623578;
EST1084 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049D031, mRNA sequence.

EL623579; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL623579;
EST1085 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049D041, mRNA sequence.

EL623580; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL623580;
EST1086 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049E061, mRNA sequence.

EL623581; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL623581;
EST1087 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049E071, mRNA sequence.

EL623582; SV 1; linear; mRNA; EST; PLN; 332 BP.
EL623582;
EST1088 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049F011, mRNA sequence.

EL623583; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL623583;
EST1089 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049F021, mRNA sequence.

EL623584; SV 1; linear; mRNA; EST; PLN; 567 BP.
EL623584;
EST1090 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049F071, mRNA sequence.

EL623585; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL623585;
EST1091 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049F101, mRNA sequence.

EL623586; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL623586;
EST1092 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049G021, mRNA sequence.

EL623587; SV 1; linear; mRNA; EST; PLN; 589 BP.
EL623587;
EST1093 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049G031, mRNA sequence.

EL623588; SV 1; linear; mRNA; EST; PLN; 621 BP.
EL623588;
EST1094 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049G071, mRNA sequence.

EL623589; SV 1; linear; mRNA; EST; PLN; 517 BP.
EL623589;
EST1095 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B049H041, mRNA sequence.

EL623590; SV 1; linear; mRNA; EST; PLN; 729 BP.
EL623590;
EST1096 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050A011, mRNA sequence.

EL623591; SV 1; linear; mRNA; EST; PLN; 725 BP.
EL623591;
EST1097 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050A081, mRNA sequence.

EL623592; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL623592;
EST1098 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050A091, mRNA sequence.

EL623593; SV 1; linear; mRNA; EST; PLN; 618 BP.
EL623593;
EST1099 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050B051, mRNA sequence.

EL623594; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL623594;
EST1100 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050B061, mRNA sequence.

EL623595; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623595;
EST1101 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050B121, mRNA sequence.

EL623596; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL623596;
EST1102 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050C041, mRNA sequence.

EL623597; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL623597;
EST1103 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050C051, mRNA sequence.

EL623598; SV 1; linear; mRNA; EST; PLN; 741 BP.
EL623598;
EST1104 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050C081, mRNA sequence.

EL623599; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL623599;
EST1105 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050C121, mRNA sequence.

EL623600; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL623600;
EST1106 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050D071, mRNA sequence.

EL623601; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL623601;
EST1107 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050D091, mRNA sequence.

EL623602; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL623602;
EST1108 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050D121, mRNA sequence.

EL623603; SV 1; linear; mRNA; EST; PLN; 462 BP.
EL623603;
EST1109 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050E041, mRNA sequence.

EL623604; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL623604;
EST1110 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050E121, mRNA sequence.

EL623605; SV 1; linear; mRNA; EST; PLN; 828 BP.
EL623605;
EST1111 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050F011, mRNA sequence.

EL623606; SV 1; linear; mRNA; EST; PLN; 835 BP.
EL623606;
EST1112 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050F021, mRNA sequence.

EL623607; SV 1; linear; mRNA; EST; PLN; 449 BP.
EL623607;
EST1113 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050F041, mRNA sequence.

EL623608; SV 1; linear; mRNA; EST; PLN; 750 BP.
EL623608;
EST1114 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050F071, mRNA sequence.

EL623609; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL623609;
EST1115 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050F081, mRNA sequence.

EL623610; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL623610;
EST1116 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050F111, mRNA sequence.

EL623611; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL623611;
EST1117 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050F121, mRNA sequence.

EL623612; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL623612;
EST1118 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050G081, mRNA sequence.

EL623613; SV 1; linear; mRNA; EST; PLN; 802 BP.
EL623613;
EST1119 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050H011, mRNA sequence.

EL623614; SV 1; linear; mRNA; EST; PLN; 390 BP.
EL623614;
EST1120 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B050H031, mRNA sequence.

EL623615; SV 1; linear; mRNA; EST; PLN; 429 BP.
EL623615;
EST1121 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051A021, mRNA sequence.

EL623616; SV 1; linear; mRNA; EST; PLN; 498 BP.
EL623616;
EST1122 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051A081, mRNA sequence.

EL623617; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL623617;
EST1123 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051A091, mRNA sequence.

EL623618; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL623618;
EST1124 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051B091, mRNA sequence.

EL623619; SV 1; linear; mRNA; EST; PLN; 297 BP.
EL623619;
EST1125 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051C031, mRNA sequence.

EL623620; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL623620;
EST1126 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051C061, mRNA sequence.

EL623621; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL623621;
EST1127 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051C071, mRNA sequence.

EL623622; SV 1; linear; mRNA; EST; PLN; 603 BP.
EL623622;
EST1128 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051D061, mRNA sequence.

EL623623; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL623623;
EST1129 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051D071, mRNA sequence.

EL623624; SV 1; linear; mRNA; EST; PLN; 472 BP.
EL623624;
EST1130 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051E021, mRNA sequence.

EL623625; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL623625;
EST1131 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051E041, mRNA sequence.

EL623626; SV 1; linear; mRNA; EST; PLN; 534 BP.
EL623626;
EST1132 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051E061, mRNA sequence.

EL623627; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL623627;
EST1133 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051E071, mRNA sequence.

EL623628; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL623628;
EST1134 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051E121, mRNA sequence.

EL623629; SV 1; linear; mRNA; EST; PLN; 442 BP.
EL623629;
EST1135 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051F011, mRNA sequence.

EL623630; SV 1; linear; mRNA; EST; PLN; 296 BP.
EL623630;
EST1136 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051F021, mRNA sequence.

EL623631; SV 1; linear; mRNA; EST; PLN; 543 BP.
EL623631;
EST1137 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051F071, mRNA sequence.

EL623632; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL623632;
EST1138 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051F101, mRNA sequence.

EL623633; SV 1; linear; mRNA; EST; PLN; 440 BP.
EL623633;
EST1139 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051G011, mRNA sequence.

EL623634; SV 1; linear; mRNA; EST; PLN; 440 BP.
EL623634;
EST1140 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051G041, mRNA sequence.

EL623635; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL623635;
EST1141 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051G051, mRNA sequence.

EL623636; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623636;
EST1142 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051G121, mRNA sequence.

EL623637; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL623637;
EST1143 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051H061, mRNA sequence.

EL623638; SV 1; linear; mRNA; EST; PLN; 623 BP.
EL623638;
EST1144 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B051H121, mRNA sequence.

EL623639; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL623639;
EST1145 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052A021, mRNA sequence.

EL623640; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL623640;
EST1146 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052A091, mRNA sequence.

EL623641; SV 1; linear; mRNA; EST; PLN; 845 BP.
EL623641;
EST1147 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052A101, mRNA sequence.

EL623642; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL623642;
EST1148 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052A121, mRNA sequence.

EL623643; SV 1; linear; mRNA; EST; PLN; 766 BP.
EL623643;
EST1149 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052B101, mRNA sequence.

EL623644; SV 1; linear; mRNA; EST; PLN; 656 BP.
EL623644;
EST1150 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052B121, mRNA sequence.

EL623645; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL623645;
EST1151 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052C031, mRNA sequence.

EL623646; SV 1; linear; mRNA; EST; PLN; 821 BP.
EL623646;
EST1152 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052C071, mRNA sequence.

EL623647; SV 1; linear; mRNA; EST; PLN; 826 BP.
EL623647;
EST1153 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052C081, mRNA sequence.

EL623648; SV 1; linear; mRNA; EST; PLN; 603 BP.
EL623648;
EST1154 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052D011, mRNA sequence.

EL623649; SV 1; linear; mRNA; EST; PLN; 769 BP.
EL623649;
EST1155 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052D031, mRNA sequence.

EL623650; SV 1; linear; mRNA; EST; PLN; 752 BP.
EL623650;
EST1156 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052D061, mRNA sequence.

EL623651; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL623651;
EST1157 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052D091, mRNA sequence.

EL623652; SV 1; linear; mRNA; EST; PLN; 648 BP.
EL623652;
EST1158 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052D121, mRNA sequence.

EL623653; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL623653;
EST1159 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052E051, mRNA sequence.

EL623654; SV 1; linear; mRNA; EST; PLN; 794 BP.
EL623654;
EST1160 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052E071, mRNA sequence.

EL623655; SV 1; linear; mRNA; EST; PLN; 625 BP.
EL623655;
EST1161 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052E111, mRNA sequence.

EL623656; SV 1; linear; mRNA; EST; PLN; 879 BP.
EL623656;
EST1162 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052F041, mRNA sequence.

EL623657; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL623657;
EST1163 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052F111, mRNA sequence.

EL623658; SV 1; linear; mRNA; EST; PLN; 653 BP.
EL623658;
EST1164 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052F121, mRNA sequence.

EL623659; SV 1; linear; mRNA; EST; PLN; 382 BP.
EL623659;
EST1165 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052G041, mRNA sequence.

EL623660; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL623660;
EST1166 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052G061, mRNA sequence.

EL623661; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL623661;
EST1167 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052G071, mRNA sequence.

EL623662; SV 1; linear; mRNA; EST; PLN; 850 BP.
EL623662;
EST1168 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052G091, mRNA sequence.

EL623663; SV 1; linear; mRNA; EST; PLN; 642 BP.
EL623663;
EST1169 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052G121, mRNA sequence.

EL623664; SV 1; linear; mRNA; EST; PLN; 862 BP.
EL623664;
EST1170 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052H021, mRNA sequence.

EL623665; SV 1; linear; mRNA; EST; PLN; 660 BP.
EL623665;
EST1171 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B052H121, mRNA sequence.

EL623666; SV 1; linear; mRNA; EST; PLN; 616 BP.
EL623666;
EST1172 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B053A081, mRNA sequence.

EL623667; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL623667;
EST1173 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B053B071, mRNA sequence.

EL623668; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL623668;
EST1174 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B053F061, mRNA sequence.

EL623669; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL623669;
EST1175 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B053H121, mRNA sequence.

EL623670; SV 1; linear; mRNA; EST; PLN; 817 BP.
EL623670;
EST1176 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054A121, mRNA sequence.

EL623671; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL623671;
EST1177 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054B081, mRNA sequence.

EL623672; SV 1; linear; mRNA; EST; PLN; 847 BP.
EL623672;
EST1178 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054B101, mRNA sequence.

EL623673; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL623673;
EST1179 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054B121, mRNA sequence.

EL623674; SV 1; linear; mRNA; EST; PLN; 826 BP.
EL623674;
EST1180 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054C111, mRNA sequence.

EL623675; SV 1; linear; mRNA; EST; PLN; 859 BP.
EL623675;
EST1181 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054G041, mRNA sequence.

EL623676; SV 1; linear; mRNA; EST; PLN; 812 BP.
EL623676;
EST1182 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054G051, mRNA sequence.

EL623677; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL623677;
EST1183 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054G091, mRNA sequence.

EL623678; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL623678;
EST1184 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054G101, mRNA sequence.

EL623679; SV 1; linear; mRNA; EST; PLN; 870 BP.
EL623679;
EST1185 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054G111, mRNA sequence.

EL623680; SV 1; linear; mRNA; EST; PLN; 860 BP.
EL623680;
EST1186 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054H031, mRNA sequence.

EL623681; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL623681;
EST1187 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B054H091, mRNA sequence.

EL623682; SV 1; linear; mRNA; EST; PLN; 506 BP.
EL623682;
EST1188 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055A011, mRNA sequence.

EL623683; SV 1; linear; mRNA; EST; PLN; 363 BP.
EL623683;
EST1189 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055A051, mRNA sequence.

EL623684; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL623684;
EST1190 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055A061, mRNA sequence.

EL623685; SV 1; linear; mRNA; EST; PLN; 534 BP.
EL623685;
EST1191 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055A101, mRNA sequence.

EL623686; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL623686;
EST1192 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055B021, mRNA sequence.

EL623687; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL623687;
EST1193 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055B071, mRNA sequence.

EL623688; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL623688;
EST1194 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055C031, mRNA sequence.

EL623689; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL623689;
EST1195 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055C091, mRNA sequence.

EL623690; SV 1; linear; mRNA; EST; PLN; 498 BP.
EL623690;
EST1196 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055C101, mRNA sequence.

EL623691; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL623691;
EST1197 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055C111, mRNA sequence.

EL623692; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL623692;
EST1198 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055D041, mRNA sequence.

EL623693; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL623693;
EST1199 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055D061, mRNA sequence.

EL623694; SV 1; linear; mRNA; EST; PLN; 474 BP.
EL623694;
EST1200 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055D101, mRNA sequence.

EL623695; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL623695;
EST1201 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055E011, mRNA sequence.

EL623696; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL623696;
EST1202 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055E021, mRNA sequence.

EL623697; SV 1; linear; mRNA; EST; PLN; 460 BP.
EL623697;
EST1203 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055E051, mRNA sequence.

EL623698; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL623698;
EST1204 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055E061, mRNA sequence.

EL623699; SV 1; linear; mRNA; EST; PLN; 612 BP.
EL623699;
EST1205 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055E081, mRNA sequence.

EL623700; SV 1; linear; mRNA; EST; PLN; 567 BP.
EL623700;
EST1206 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055E121, mRNA sequence.

EL623701; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL623701;
EST1207 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055F051, mRNA sequence.

EL623702; SV 1; linear; mRNA; EST; PLN; 373 BP.
EL623702;
EST1208 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055F071, mRNA sequence.

EL623703; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL623703;
EST1209 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055F101, mRNA sequence.

EL623704; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL623704;
EST1210 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055G041, mRNA sequence.

EL623705; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL623705;
EST1211 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055G051, mRNA sequence.

EL623706; SV 1; linear; mRNA; EST; PLN; 600 BP.
EL623706;
EST1212 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055G071, mRNA sequence.

EL623707; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL623707;
EST1213 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055G081, mRNA sequence.

EL623708; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL623708;
EST1214 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055G091, mRNA sequence.

EL623709; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL623709;
EST1215 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055H011, mRNA sequence.

EL623710; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL623710;
EST1216 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055H081, mRNA sequence.

EL623711; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL623711;
EST1217 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055H111, mRNA sequence.

EL623712; SV 1; linear; mRNA; EST; PLN; 580 BP.
EL623712;
EST1218 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B055H121, mRNA sequence.

EL623713; SV 1; linear; mRNA; EST; PLN; 491 BP.
EL623713;
EST1219 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056A041, mRNA sequence.

EL623714; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL623714;
EST1220 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056A061, mRNA sequence.

EL623715; SV 1; linear; mRNA; EST; PLN; 480 BP.
EL623715;
EST1221 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056A071, mRNA sequence.

EL623716; SV 1; linear; mRNA; EST; PLN; 543 BP.
EL623716;
EST1222 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056A081, mRNA sequence.

EL623717; SV 1; linear; mRNA; EST; PLN; 480 BP.
EL623717;
EST1223 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056A091, mRNA sequence.

EL623718; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL623718;
EST1224 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056A101, mRNA sequence.

EL623719; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL623719;
EST1225 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056A121, mRNA sequence.

EL623720; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL623720;
EST1226 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056B031, mRNA sequence.

EL623721; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL623721;
EST1227 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056B041, mRNA sequence.

EL623722; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL623722;
EST1228 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056B081, mRNA sequence.

EL623723; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL623723;
EST1229 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056B091, mRNA sequence.

EL623724; SV 1; linear; mRNA; EST; PLN; 288 BP.
EL623724;
EST1230 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056C011, mRNA sequence.

EL623725; SV 1; linear; mRNA; EST; PLN; 474 BP.
EL623725;
EST1231 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056C071, mRNA sequence.

EL623726; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL623726;
EST1232 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056C111, mRNA sequence.

EL623727; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL623727;
EST1233 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056D071, mRNA sequence.

EL623728; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL623728;
EST1234 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056D091, mRNA sequence.

EL623729; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL623729;
EST1235 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056E031, mRNA sequence.

EL623730; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL623730;
EST1236 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056E041, mRNA sequence.

EL623731; SV 1; linear; mRNA; EST; PLN; 356 BP.
EL623731;
EST1237 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056E121, mRNA sequence.

EL623732; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL623732;
EST1238 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056F041, mRNA sequence.

EL623733; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL623733;
EST1239 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056F081, mRNA sequence.

EL623734; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL623734;
EST1240 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056F111, mRNA sequence.

EL623735; SV 1; linear; mRNA; EST; PLN; 431 BP.
EL623735;
EST1241 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056G031, mRNA sequence.

EL623736; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL623736;
EST1242 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056G051, mRNA sequence.

EL623737; SV 1; linear; mRNA; EST; PLN; 502 BP.
EL623737;
EST1243 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056G061, mRNA sequence.

EL623738; SV 1; linear; mRNA; EST; PLN; 422 BP.
EL623738;
EST1244 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056G091, mRNA sequence.

EL623739; SV 1; linear; mRNA; EST; PLN; 472 BP.
EL623739;
EST1245 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056G101, mRNA sequence.

EL623740; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL623740;
EST1246 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056G111, mRNA sequence.

EL623741; SV 1; linear; mRNA; EST; PLN; 837 BP.
EL623741;
EST1247 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056H021, mRNA sequence.

EL623742; SV 1; linear; mRNA; EST; PLN; 390 BP.
EL623742;
EST1248 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056H031, mRNA sequence.

EL623743; SV 1; linear; mRNA; EST; PLN; 471 BP.
EL623743;
EST1249 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056H081, mRNA sequence.

EL623744; SV 1; linear; mRNA; EST; PLN; 299 BP.
EL623744;
EST1250 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056H091, mRNA sequence.

EL623745; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL623745;
EST1251 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B056H101, mRNA sequence.

EL623746; SV 1; linear; mRNA; EST; PLN; 429 BP.
EL623746;
EST1252 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057A011, mRNA sequence.

EL623747; SV 1; linear; mRNA; EST; PLN; 436 BP.
EL623747;
EST1253 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057A021, mRNA sequence.

EL623748; SV 1; linear; mRNA; EST; PLN; 389 BP.
EL623748;
EST1254 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057A031, mRNA sequence.

EL623749; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL623749;
EST1255 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057A071, mRNA sequence.

EL623750; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL623750;
EST1256 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057A111, mRNA sequence.

EL623751; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL623751;
EST1257 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057A121, mRNA sequence.

EL623752; SV 1; linear; mRNA; EST; PLN; 463 BP.
EL623752;
EST1258 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057B061, mRNA sequence.

EL623753; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL623753;
EST1259 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057B121, mRNA sequence.

EL623754; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL623754;
EST1260 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057C041, mRNA sequence.

EL623755; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL623755;
EST1261 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057C051, mRNA sequence.

EL623756; SV 1; linear; mRNA; EST; PLN; 469 BP.
EL623756;
EST1262 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057C081, mRNA sequence.

EL623757; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL623757;
EST1263 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057D051, mRNA sequence.

EL623758; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL623758;
EST1264 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057D071, mRNA sequence.

EL623759; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL623759;
EST1265 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057D091, mRNA sequence.

EL623760; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL623760;
EST1266 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057E091, mRNA sequence.

EL623761; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL623761;
EST1267 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057E121, mRNA sequence.

EL623762; SV 1; linear; mRNA; EST; PLN; 419 BP.
EL623762;
EST1268 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057F031, mRNA sequence.

EL623763; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL623763;
EST1269 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057F061, mRNA sequence.

EL623764; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL623764;
EST1270 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057F071, mRNA sequence.

EL623765; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL623765;
EST1271 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057F081, mRNA sequence.

EL623766; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL623766;
EST1272 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057F101, mRNA sequence.

EL623767; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL623767;
EST1273 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057F121, mRNA sequence.

EL623768; SV 1; linear; mRNA; EST; PLN; 447 BP.
EL623768;
EST1274 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057G021, mRNA sequence.

EL623769; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL623769;
EST1275 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057G091, mRNA sequence.

EL623770; SV 1; linear; mRNA; EST; PLN; 627 BP.
EL623770;
EST1276 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057G101, mRNA sequence.

EL623771; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL623771;
EST1277 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057G121, mRNA sequence.

EL623772; SV 1; linear; mRNA; EST; PLN; 407 BP.
EL623772;
EST1278 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057H031, mRNA sequence.

EL623773; SV 1; linear; mRNA; EST; PLN; 495 BP.
EL623773;
EST1279 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057H061, mRNA sequence.

EL623774; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL623774;
EST1280 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057H081, mRNA sequence.

EL623775; SV 1; linear; mRNA; EST; PLN; 373 BP.
EL623775;
EST1281 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057H101, mRNA sequence.

EL623776; SV 1; linear; mRNA; EST; PLN; 580 BP.
EL623776;
EST1282 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B057H111, mRNA sequence.

EL623777; SV 1; linear; mRNA; EST; PLN; 682 BP.
EL623777;
EST1283 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058A021, mRNA sequence.

EL623778; SV 1; linear; mRNA; EST; PLN; 753 BP.
EL623778;
EST1284 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058A071, mRNA sequence.

EL623779; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL623779;
EST1285 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058B091, mRNA sequence.

EL623780; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL623780;
EST1286 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058B101, mRNA sequence.

EL623781; SV 1; linear; mRNA; EST; PLN; 821 BP.
EL623781;
EST1287 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058C031, mRNA sequence.

EL623782; SV 1; linear; mRNA; EST; PLN; 900 BP.
EL623782;
EST1288 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058C081, mRNA sequence.

EL623783; SV 1; linear; mRNA; EST; PLN; 731 BP.
EL623783;
EST1289 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058C101, mRNA sequence.

EL623784; SV 1; linear; mRNA; EST; PLN; 630 BP.
EL623784;
EST1290 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058D011, mRNA sequence.

EL623785; SV 1; linear; mRNA; EST; PLN; 668 BP.
EL623785;
EST1291 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058D021, mRNA sequence.

EL623786; SV 1; linear; mRNA; EST; PLN; 766 BP.
EL623786;
EST1292 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058D031, mRNA sequence.

EL623787; SV 1; linear; mRNA; EST; PLN; 664 BP.
EL623787;
EST1293 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058D051, mRNA sequence.

EL623788; SV 1; linear; mRNA; EST; PLN; 668 BP.
EL623788;
EST1294 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058D061, mRNA sequence.

EL623789; SV 1; linear; mRNA; EST; PLN; 819 BP.
EL623789;
EST1295 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058D091, mRNA sequence.

EL623790; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL623790;
EST1296 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058D101, mRNA sequence.

EL623791; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL623791;
EST1297 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058D121, mRNA sequence.

EL623792; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL623792;
EST1298 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058E021, mRNA sequence.

EL623793; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL623793;
EST1299 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058E041, mRNA sequence.

EL623794; SV 1; linear; mRNA; EST; PLN; 602 BP.
EL623794;
EST1300 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058E051, mRNA sequence.

EL623795; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL623795;
EST1301 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058E071, mRNA sequence.

EL623796; SV 1; linear; mRNA; EST; PLN; 775 BP.
EL623796;
EST1302 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058E111, mRNA sequence.

EL623797; SV 1; linear; mRNA; EST; PLN; 666 BP.
EL623797;
EST1303 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058F011, mRNA sequence.

EL623798; SV 1; linear; mRNA; EST; PLN; 865 BP.
EL623798;
EST1304 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058F031, mRNA sequence.

EL623799; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL623799;
EST1305 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058F081, mRNA sequence.

EL623800; SV 1; linear; mRNA; EST; PLN; 758 BP.
EL623800;
EST1306 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058F101, mRNA sequence.

EL623801; SV 1; linear; mRNA; EST; PLN; 795 BP.
EL623801;
EST1307 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058F111, mRNA sequence.

EL623802; SV 1; linear; mRNA; EST; PLN; 657 BP.
EL623802;
EST1308 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058G011, mRNA sequence.

EL623803; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL623803;
EST1309 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058G021, mRNA sequence.

EL623804; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL623804;
EST1310 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058G051, mRNA sequence.

EL623805; SV 1; linear; mRNA; EST; PLN; 769 BP.
EL623805;
EST1311 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058G091, mRNA sequence.

EL623806; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL623806;
EST1312 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058G101, mRNA sequence.

EL623807; SV 1; linear; mRNA; EST; PLN; 869 BP.
EL623807;
EST1313 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058H031, mRNA sequence.

EL623808; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL623808;
EST1314 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058H051, mRNA sequence.

EL623809; SV 1; linear; mRNA; EST; PLN; 840 BP.
EL623809;
EST1315 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058H071, mRNA sequence.

EL623810; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL623810;
EST1316 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058H081, mRNA sequence.

EL623811; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL623811;
EST1317 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B058H121, mRNA sequence.

EL623812; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL623812;
EST1318 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059A011, mRNA sequence.

EL623813; SV 1; linear; mRNA; EST; PLN; 568 BP.
EL623813;
EST1319 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059A021, mRNA sequence.

EL623814; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL623814;
EST1320 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059A031, mRNA sequence.

EL623815; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL623815;
EST1321 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059A041, mRNA sequence.

EL623816; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL623816;
EST1322 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059A071, mRNA sequence.

EL623817; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL623817;
EST1323 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059A081, mRNA sequence.

EL623818; SV 1; linear; mRNA; EST; PLN; 490 BP.
EL623818;
EST1324 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059A111, mRNA sequence.

EL623819; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL623819;
EST1325 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059B011, mRNA sequence.

EL623820; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL623820;
EST1326 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059B031, mRNA sequence.

EL623821; SV 1; linear; mRNA; EST; PLN; 517 BP.
EL623821;
EST1327 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059B061, mRNA sequence.

EL623822; SV 1; linear; mRNA; EST; PLN; 263 BP.
EL623822;
EST1328 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059B111, mRNA sequence.

EL623823; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL623823;
EST1329 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059C011, mRNA sequence.

EL623824; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623824;
EST1330 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059C021, mRNA sequence.

EL623825; SV 1; linear; mRNA; EST; PLN; 351 BP.
EL623825;
EST1331 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059C051, mRNA sequence.

EL623826; SV 1; linear; mRNA; EST; PLN; 543 BP.
EL623826;
EST1332 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059C061, mRNA sequence.

EL623827; SV 1; linear; mRNA; EST; PLN; 619 BP.
EL623827;
EST1333 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059C091, mRNA sequence.

EL623828; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL623828;
EST1334 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059C101, mRNA sequence.

EL623829; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL623829;
EST1335 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059D031, mRNA sequence.

EL623830; SV 1; linear; mRNA; EST; PLN; 663 BP.
EL623830;
EST1336 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059D091, mRNA sequence.

EL623831; SV 1; linear; mRNA; EST; PLN; 433 BP.
EL623831;
EST1337 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059E021, mRNA sequence.

EL623832; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623832;
EST1338 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059E031, mRNA sequence.

EL623833; SV 1; linear; mRNA; EST; PLN; 454 BP.
EL623833;
EST1339 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059E061, mRNA sequence.

EL623834; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL623834;
EST1340 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059E071, mRNA sequence.

EL623835; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL623835;
EST1341 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059F021, mRNA sequence.

EL623836; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL623836;
EST1342 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059F061, mRNA sequence.

EL623837; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL623837;
EST1343 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059F091, mRNA sequence.

EL623838; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL623838;
EST1344 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059F101, mRNA sequence.

EL623839; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL623839;
EST1345 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059F111, mRNA sequence.

EL623840; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL623840;
EST1346 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059G011, mRNA sequence.

EL623841; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL623841;
EST1347 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059H011, mRNA sequence.

EL623842; SV 1; linear; mRNA; EST; PLN; 530 BP.
EL623842;
EST1348 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059H041, mRNA sequence.

EL623843; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL623843;
EST1349 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059H061, mRNA sequence.

EL623844; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL623844;
EST1350 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059H081, mRNA sequence.

EL623845; SV 1; linear; mRNA; EST; PLN; 629 BP.
EL623845;
EST1351 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059H091, mRNA sequence.

EL623846; SV 1; linear; mRNA; EST; PLN; 196 BP.
EL623846;
EST1352 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B059H111, mRNA sequence.

EL623847; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL623847;
EST1353 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060A061, mRNA sequence.

EL623848; SV 1; linear; mRNA; EST; PLN; 708 BP.
EL623848;
EST1354 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060A101, mRNA sequence.

EL623849; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL623849;
EST1355 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060B031, mRNA sequence.

EL623850; SV 1; linear; mRNA; EST; PLN; 719 BP.
EL623850;
EST1356 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060B101, mRNA sequence.

EL623851; SV 1; linear; mRNA; EST; PLN; 782 BP.
EL623851;
EST1357 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060B121, mRNA sequence.

EL623852; SV 1; linear; mRNA; EST; PLN; 371 BP.
EL623852;
EST1358 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060C011, mRNA sequence.

EL623853; SV 1; linear; mRNA; EST; PLN; 832 BP.
EL623853;
EST1359 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060C061, mRNA sequence.

EL623854; SV 1; linear; mRNA; EST; PLN; 805 BP.
EL623854;
EST1360 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060C081, mRNA sequence.

EL623855; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL623855;
EST1361 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060C101, mRNA sequence.

EL623856; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL623856;
EST1362 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060D011, mRNA sequence.

EL623857; SV 1; linear; mRNA; EST; PLN; 352 BP.
EL623857;
EST1363 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060D021, mRNA sequence.

EL623858; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL623858;
EST1364 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060D031, mRNA sequence.

EL623859; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL623859;
EST1365 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060D061, mRNA sequence.

EL623860; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL623860;
EST1366 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060D071, mRNA sequence.

EL623861; SV 1; linear; mRNA; EST; PLN; 769 BP.
EL623861;
EST1367 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060D101, mRNA sequence.

EL623862; SV 1; linear; mRNA; EST; PLN; 432 BP.
EL623862;
EST1368 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060E021, mRNA sequence.

EL623863; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL623863;
EST1369 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060E081, mRNA sequence.

EL623864; SV 1; linear; mRNA; EST; PLN; 402 BP.
EL623864;
EST1370 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060F011, mRNA sequence.

EL623865; SV 1; linear; mRNA; EST; PLN; 608 BP.
EL623865;
EST1371 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060F031, mRNA sequence.

EL623866; SV 1; linear; mRNA; EST; PLN; 669 BP.
EL623866;
EST1372 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060F041, mRNA sequence.

EL623867; SV 1; linear; mRNA; EST; PLN; 837 BP.
EL623867;
EST1373 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060F051, mRNA sequence.

EL623868; SV 1; linear; mRNA; EST; PLN; 829 BP.
EL623868;
EST1374 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060F061, mRNA sequence.

EL623869; SV 1; linear; mRNA; EST; PLN; 444 BP.
EL623869;
EST1375 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060G011, mRNA sequence.

EL623870; SV 1; linear; mRNA; EST; PLN; 812 BP.
EL623870;
EST1376 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060G071, mRNA sequence.

EL623871; SV 1; linear; mRNA; EST; PLN; 723 BP.
EL623871;
EST1377 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060G091, mRNA sequence.

EL623872; SV 1; linear; mRNA; EST; PLN; 802 BP.
EL623872;
EST1378 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060G111, mRNA sequence.

EL623873; SV 1; linear; mRNA; EST; PLN; 820 BP.
EL623873;
EST1379 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060H061, mRNA sequence.

EL623874; SV 1; linear; mRNA; EST; PLN; 770 BP.
EL623874;
EST1380 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B060H111, mRNA sequence.

EL623875; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL623875;
EST1381 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061A041, mRNA sequence.

EL623876; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623876;
EST1382 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061A051, mRNA sequence.

EL623877; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL623877;
EST1383 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061A121, mRNA sequence.

EL623878; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL623878;
EST1384 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061B021, mRNA sequence.

EL623879; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL623879;
EST1385 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061B031, mRNA sequence.

EL623880; SV 1; linear; mRNA; EST; PLN; 517 BP.
EL623880;
EST1386 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061B051, mRNA sequence.

EL623881; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL623881;
EST1387 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061B071, mRNA sequence.

EL623882; SV 1; linear; mRNA; EST; PLN; 481 BP.
EL623882;
EST1388 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061B121, mRNA sequence.

EL623883; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL623883;
EST1389 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061C011, mRNA sequence.

EL623884; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL623884;
EST1390 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061C021, mRNA sequence.

EL623885; SV 1; linear; mRNA; EST; PLN; 664 BP.
EL623885;
EST1391 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061C071, mRNA sequence.

EL623886; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL623886;
EST1392 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061C081, mRNA sequence.

EL623887; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL623887;
EST1393 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061C101, mRNA sequence.

EL623888; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL623888;
EST1394 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061D061, mRNA sequence.

EL623889; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL623889;
EST1395 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061D091, mRNA sequence.

EL623890; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL623890;
EST1396 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061E011, mRNA sequence.

EL623891; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL623891;
EST1397 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061E031, mRNA sequence.

EL623892; SV 1; linear; mRNA; EST; PLN; 543 BP.
EL623892;
EST1398 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061E051, mRNA sequence.

EL623893; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL623893;
EST1399 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061E061, mRNA sequence.

EL623894; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL623894;
EST1400 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061E081, mRNA sequence.

EL623895; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL623895;
EST1401 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061E101, mRNA sequence.

EL623896; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL623896;
EST1402 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061E121, mRNA sequence.

EL623897; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL623897;
EST1403 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061F031, mRNA sequence.

EL623898; SV 1; linear; mRNA; EST; PLN; 525 BP.
EL623898;
EST1404 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061F051, mRNA sequence.

EL623899; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL623899;
EST1405 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061F121, mRNA sequence.

EL623900; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL623900;
EST1406 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061G021, mRNA sequence.

EL623901; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL623901;
EST1407 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061G051, mRNA sequence.

EL623902; SV 1; linear; mRNA; EST; PLN; 493 BP.
EL623902;
EST1408 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061G101, mRNA sequence.

EL623903; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL623903;
EST1409 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061H021, mRNA sequence.

EL623904; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL623904;
EST1410 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061H051, mRNA sequence.

EL623905; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL623905;
EST1411 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B061H111, mRNA sequence.

EL623906; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL623906;
EST1412 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062A041, mRNA sequence.

EL623907; SV 1; linear; mRNA; EST; PLN; 481 BP.
EL623907;
EST1413 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062A091, mRNA sequence.

EL623908; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL623908;
EST1414 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062A101, mRNA sequence.

EL623909; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL623909;
EST1415 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062B041, mRNA sequence.

EL623910; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL623910;
EST1416 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062B051, mRNA sequence.

EL623911; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL623911;
EST1417 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062B071, mRNA sequence.

EL623912; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL623912;
EST1418 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062B091, mRNA sequence.

EL623913; SV 1; linear; mRNA; EST; PLN; 552 BP.
EL623913;
EST1419 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062B111, mRNA sequence.

EL623914; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL623914;
EST1420 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062C031, mRNA sequence.

EL623915; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL623915;
EST1421 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062C051, mRNA sequence.

EL623916; SV 1; linear; mRNA; EST; PLN; 530 BP.
EL623916;
EST1422 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062C061, mRNA sequence.

EL623917; SV 1; linear; mRNA; EST; PLN; 533 BP.
EL623917;
EST1423 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062C091, mRNA sequence.

EL623918; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL623918;
EST1424 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062C111, mRNA sequence.

EL623919; SV 1; linear; mRNA; EST; PLN; 493 BP.
EL623919;
EST1425 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062D031, mRNA sequence.

EL623920; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL623920;
EST1426 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062D071, mRNA sequence.

EL623921; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL623921;
EST1427 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062D091, mRNA sequence.

EL623922; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL623922;
EST1428 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062E011, mRNA sequence.

EL623923; SV 1; linear; mRNA; EST; PLN; 428 BP.
EL623923;
EST1429 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062E041, mRNA sequence.

EL623924; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL623924;
EST1430 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062E071, mRNA sequence.

EL623925; SV 1; linear; mRNA; EST; PLN; 368 BP.
EL623925;
EST1431 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062E091, mRNA sequence.

EL623926; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL623926;
EST1432 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062E101, mRNA sequence.

EL623927; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL623927;
EST1433 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062F021, mRNA sequence.

EL623928; SV 1; linear; mRNA; EST; PLN; 512 BP.
EL623928;
EST1434 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062F051, mRNA sequence.

EL623929; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL623929;
EST1435 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062F111, mRNA sequence.

EL623930; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL623930;
EST1436 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062G011, mRNA sequence.

EL623931; SV 1; linear; mRNA; EST; PLN; 395 BP.
EL623931;
EST1437 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062G041, mRNA sequence.

EL623932; SV 1; linear; mRNA; EST; PLN; 401 BP.
EL623932;
EST1438 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062H031, mRNA sequence.

EL623933; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL623933;
EST1439 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062H061, mRNA sequence.

EL623934; SV 1; linear; mRNA; EST; PLN; 675 BP.
EL623934;
EST1440 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062H081, mRNA sequence.

EL623935; SV 1; linear; mRNA; EST; PLN; 427 BP.
EL623935;
EST1441 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062H091, mRNA sequence.

EL623936; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL623936;
EST1442 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B062H111, mRNA sequence.

EL623937; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL623937;
EST1443 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063A031, mRNA sequence.

EL623938; SV 1; linear; mRNA; EST; PLN; 453 BP.
EL623938;
EST1444 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063A041, mRNA sequence.

EL623939; SV 1; linear; mRNA; EST; PLN; 587 BP.
EL623939;
EST1445 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063A051, mRNA sequence.

EL623940; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL623940;
EST1446 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063A061, mRNA sequence.

EL623941; SV 1; linear; mRNA; EST; PLN; 724 BP.
EL623941;
EST1447 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063A081, mRNA sequence.

EL623942; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL623942;
EST1448 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063A091, mRNA sequence.

EL623943; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL623943;
EST1449 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063A101, mRNA sequence.

EL623944; SV 1; linear; mRNA; EST; PLN; 249 BP.
EL623944;
EST1450 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063B021, mRNA sequence.

EL623945; SV 1; linear; mRNA; EST; PLN; 883 BP.
EL623945;
EST1451 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063B061, mRNA sequence.

EL623946; SV 1; linear; mRNA; EST; PLN; 746 BP.
EL623946;
EST1452 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063B071, mRNA sequence.

EL623947; SV 1; linear; mRNA; EST; PLN; 604 BP.
EL623947;
EST1453 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063B121, mRNA sequence.

EL623948; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL623948;
EST1454 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063C021, mRNA sequence.

EL623949; SV 1; linear; mRNA; EST; PLN; 874 BP.
EL623949;
EST1455 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063C041, mRNA sequence.

EL623950; SV 1; linear; mRNA; EST; PLN; 433 BP.
EL623950;
EST1456 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063C051, mRNA sequence.

EL623951; SV 1; linear; mRNA; EST; PLN; 752 BP.
EL623951;
EST1457 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063C071, mRNA sequence.

EL623952; SV 1; linear; mRNA; EST; PLN; 600 BP.
EL623952;
EST1458 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063D011, mRNA sequence.

EL623953; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL623953;
EST1459 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063D021, mRNA sequence.

EL623954; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL623954;
EST1460 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063D031, mRNA sequence.

EL623955; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL623955;
EST1461 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063D051, mRNA sequence.

EL623956; SV 1; linear; mRNA; EST; PLN; 654 BP.
EL623956;
EST1462 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063D071, mRNA sequence.

EL623957; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL623957;
EST1463 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063E051, mRNA sequence.

EL623958; SV 1; linear; mRNA; EST; PLN; 652 BP.
EL623958;
EST1464 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063F031, mRNA sequence.

EL623959; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL623959;
EST1465 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063F051, mRNA sequence.

EL623960; SV 1; linear; mRNA; EST; PLN; 849 BP.
EL623960;
EST1466 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063F061, mRNA sequence.

EL623961; SV 1; linear; mRNA; EST; PLN; 316 BP.
EL623961;
EST1467 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063F091, mRNA sequence.

EL623962; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL623962;
EST1468 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063F111, mRNA sequence.

EL623963; SV 1; linear; mRNA; EST; PLN; 860 BP.
EL623963;
EST1469 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063G031, mRNA sequence.

EL623964; SV 1; linear; mRNA; EST; PLN; 646 BP.
EL623964;
EST1470 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063G051, mRNA sequence.

EL623965; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL623965;
EST1471 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063G091, mRNA sequence.

EL623966; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL623966;
EST1472 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063H061, mRNA sequence.

EL623967; SV 1; linear; mRNA; EST; PLN; 914 BP.
EL623967;
EST1473 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063H071, mRNA sequence.

EL623968; SV 1; linear; mRNA; EST; PLN; 637 BP.
EL623968;
EST1474 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063H101, mRNA sequence.

EL623969; SV 1; linear; mRNA; EST; PLN; 965 BP.
EL623969;
EST1475 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063H111, mRNA sequence.

EL623970; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL623970;
EST1476 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B063H121, mRNA sequence.

EL623971; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL623971;
EST1477 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064A051, mRNA sequence.

EL623972; SV 1; linear; mRNA; EST; PLN; 752 BP.
EL623972;
EST1478 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064A101, mRNA sequence.

EL623973; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL623973;
EST1479 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064A111, mRNA sequence.

EL623974; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL623974;
EST1480 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064B031, mRNA sequence.

EL623975; SV 1; linear; mRNA; EST; PLN; 832 BP.
EL623975;
EST1481 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064B041, mRNA sequence.

EL623976; SV 1; linear; mRNA; EST; PLN; 568 BP.
EL623976;
EST1482 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064B061, mRNA sequence.

EL623977; SV 1; linear; mRNA; EST; PLN; 668 BP.
EL623977;
EST1483 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064B091, mRNA sequence.

EL623978; SV 1; linear; mRNA; EST; PLN; 827 BP.
EL623978;
EST1484 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064B101, mRNA sequence.

EL623979; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL623979;
EST1485 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064C011, mRNA sequence.

EL623980; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL623980;
EST1486 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064C031, mRNA sequence.

EL623981; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL623981;
EST1487 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064C071, mRNA sequence.

EL623982; SV 1; linear; mRNA; EST; PLN; 444 BP.
EL623982;
EST1488 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064D031, mRNA sequence.

EL623983; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL623983;
EST1489 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064D071, mRNA sequence.

EL623984; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL623984;
EST1490 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064D111, mRNA sequence.

EL623985; SV 1; linear; mRNA; EST; PLN; 455 BP.
EL623985;
EST1491 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064E011, mRNA sequence.

EL623986; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL623986;
EST1492 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064E051, mRNA sequence.

EL623987; SV 1; linear; mRNA; EST; PLN; 365 BP.
EL623987;
EST1493 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064E061, mRNA sequence.

EL623988; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL623988;
EST1494 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064E071, mRNA sequence.

EL623989; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL623989;
EST1495 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064E101, mRNA sequence.

EL623990; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL623990;
EST1496 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064E111, mRNA sequence.

EL623991; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL623991;
EST1497 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064E121, mRNA sequence.

EL623992; SV 1; linear; mRNA; EST; PLN; 534 BP.
EL623992;
EST1498 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064F051, mRNA sequence.

EL623993; SV 1; linear; mRNA; EST; PLN; 471 BP.
EL623993;
EST1499 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064F061, mRNA sequence.

EL623994; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL623994;
EST1500 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064F091, mRNA sequence.

EL623995; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL623995;
EST1501 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064F101, mRNA sequence.

EL623996; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL623996;
EST1502 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064F111, mRNA sequence.

EL623997; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL623997;
EST1503 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064G021, mRNA sequence.

EL623998; SV 1; linear; mRNA; EST; PLN; 627 BP.
EL623998;
EST1504 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064G081, mRNA sequence.

EL623999; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL623999;
EST1505 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064G091, mRNA sequence.

EL624000; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL624000;
EST1506 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064G111, mRNA sequence.

EL624001; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL624001;
EST1507 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064G121, mRNA sequence.

EL624002; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL624002;
EST1508 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064H011, mRNA sequence.

EL624003; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL624003;
EST1509 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064H071, mRNA sequence.

EL624004; SV 1; linear; mRNA; EST; PLN; 600 BP.
EL624004;
EST1510 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B064H121, mRNA sequence.

EL624005; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL624005;
EST1511 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065A011, mRNA sequence.

EL624006; SV 1; linear; mRNA; EST; PLN; 587 BP.
EL624006;
EST1512 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065A071, mRNA sequence.

EL624007; SV 1; linear; mRNA; EST; PLN; 306 BP.
EL624007;
EST1513 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065B041, mRNA sequence.

EL624008; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL624008;
EST1514 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065B061, mRNA sequence.

EL624009; SV 1; linear; mRNA; EST; PLN; 640 BP.
EL624009;
EST1515 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065B121, mRNA sequence.

EL624010; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL624010;
EST1516 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065C021, mRNA sequence.

EL624011; SV 1; linear; mRNA; EST; PLN; 670 BP.
EL624011;
EST1517 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065C031, mRNA sequence.

EL624012; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL624012;
EST1518 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065C061, mRNA sequence.

EL624013; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL624013;
EST1519 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065C091, mRNA sequence.

EL624014; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL624014;
EST1520 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065C111, mRNA sequence.

EL624015; SV 1; linear; mRNA; EST; PLN; 450 BP.
EL624015;
EST1521 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065D011, mRNA sequence.

EL624016; SV 1; linear; mRNA; EST; PLN; 642 BP.
EL624016;
EST1522 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065D021, mRNA sequence.

EL624017; SV 1; linear; mRNA; EST; PLN; 603 BP.
EL624017;
EST1523 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065D041, mRNA sequence.

EL624018; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL624018;
EST1524 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065D111, mRNA sequence.

EL624019; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL624019;
EST1525 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065E011, mRNA sequence.

EL624020; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL624020;
EST1526 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065E021, mRNA sequence.

EL624021; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL624021;
EST1527 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065E031, mRNA sequence.

EL624022; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL624022;
EST1528 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065E041, mRNA sequence.

EL624023; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL624023;
EST1529 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065E091, mRNA sequence.

EL624024; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL624024;
EST1530 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065E101, mRNA sequence.

EL624025; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL624025;
EST1531 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065E111, mRNA sequence.

EL624026; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL624026;
EST1532 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065E121, mRNA sequence.

EL624027; SV 1; linear; mRNA; EST; PLN; 373 BP.
EL624027;
EST1533 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065F061, mRNA sequence.

EL624028; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL624028;
EST1534 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065F071, mRNA sequence.

EL624029; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL624029;
EST1535 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065F081, mRNA sequence.

EL624030; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL624030;
EST1536 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065F101, mRNA sequence.

EL624031; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL624031;
EST1537 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065F111, mRNA sequence.

EL624032; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL624032;
EST1538 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065F121, mRNA sequence.

EL624033; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL624033;
EST1539 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065G021, mRNA sequence.

EL624034; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL624034;
EST1540 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065G041, mRNA sequence.

EL624035; SV 1; linear; mRNA; EST; PLN; 617 BP.
EL624035;
EST1541 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065G111, mRNA sequence.

EL624036; SV 1; linear; mRNA; EST; PLN; 643 BP.
EL624036;
EST1542 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065H011, mRNA sequence.

EL624037; SV 1; linear; mRNA; EST; PLN; 676 BP.
EL624037;
EST1543 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B065H041, mRNA sequence.

EL624038; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL624038;
EST1544 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066A021, mRNA sequence.

EL624039; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL624039;
EST1545 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066A061, mRNA sequence.

EL624040; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL624040;
EST1546 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066A091, mRNA sequence.

EL624041; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL624041;
EST1547 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066A101, mRNA sequence.

EL624042; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL624042;
EST1548 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066A111, mRNA sequence.

EL624043; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL624043;
EST1549 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066B011, mRNA sequence.

EL624044; SV 1; linear; mRNA; EST; PLN; 812 BP.
EL624044;
EST1550 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066B031, mRNA sequence.

EL624045; SV 1; linear; mRNA; EST; PLN; 781 BP.
EL624045;
EST1551 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066B071, mRNA sequence.

EL624046; SV 1; linear; mRNA; EST; PLN; 771 BP.
EL624046;
EST1552 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066B101, mRNA sequence.

EL624047; SV 1; linear; mRNA; EST; PLN; 851 BP.
EL624047;
EST1553 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066C051, mRNA sequence.

EL624048; SV 1; linear; mRNA; EST; PLN; 826 BP.
EL624048;
EST1554 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066C061, mRNA sequence.

EL624049; SV 1; linear; mRNA; EST; PLN; 823 BP.
EL624049;
EST1555 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066C081, mRNA sequence.

EL624050; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL624050;
EST1556 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066C121, mRNA sequence.

EL624051; SV 1; linear; mRNA; EST; PLN; 855 BP.
EL624051;
EST1557 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066D041, mRNA sequence.

EL624052; SV 1; linear; mRNA; EST; PLN; 865 BP.
EL624052;
EST1558 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066D121, mRNA sequence.

EL624053; SV 1; linear; mRNA; EST; PLN; 805 BP.
EL624053;
EST1559 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066E021, mRNA sequence.

EL624054; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL624054;
EST1560 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066E041, mRNA sequence.

EL624055; SV 1; linear; mRNA; EST; PLN; 841 BP.
EL624055;
EST1561 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066E061, mRNA sequence.

EL624056; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL624056;
EST1562 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066E091, mRNA sequence.

EL624057; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL624057;
EST1563 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066E121, mRNA sequence.

EL624058; SV 1; linear; mRNA; EST; PLN; 676 BP.
EL624058;
EST1564 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066F021, mRNA sequence.

EL624059; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL624059;
EST1565 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066F081, mRNA sequence.

EL624060; SV 1; linear; mRNA; EST; PLN; 627 BP.
EL624060;
EST1566 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066G011, mRNA sequence.

EL624061; SV 1; linear; mRNA; EST; PLN; 870 BP.
EL624061;
EST1567 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066G031, mRNA sequence.

EL624062; SV 1; linear; mRNA; EST; PLN; 879 BP.
EL624062;
EST1568 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066G051, mRNA sequence.

EL624063; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL624063;
EST1569 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066G061, mRNA sequence.

EL624064; SV 1; linear; mRNA; EST; PLN; 819 BP.
EL624064;
EST1570 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066G071, mRNA sequence.

EL624065; SV 1; linear; mRNA; EST; PLN; 897 BP.
EL624065;
EST1571 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066G101, mRNA sequence.

EL624066; SV 1; linear; mRNA; EST; PLN; 852 BP.
EL624066;
EST1572 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066H051, mRNA sequence.

EL624067; SV 1; linear; mRNA; EST; PLN; 777 BP.
EL624067;
EST1573 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B066H111, mRNA sequence.

EL624068; SV 1; linear; mRNA; EST; PLN; 803 BP.
EL624068;
EST1574 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067A031, mRNA sequence.

EL624069; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL624069;
EST1575 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067B031, mRNA sequence.

EL624070; SV 1; linear; mRNA; EST; PLN; 883 BP.
EL624070;
EST1576 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067B061, mRNA sequence.

EL624071; SV 1; linear; mRNA; EST; PLN; 507 BP.
EL624071;
EST1577 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067B121, mRNA sequence.

EL624072; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL624072;
EST1578 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067C021, mRNA sequence.

EL624073; SV 1; linear; mRNA; EST; PLN; 820 BP.
EL624073;
EST1579 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067C031, mRNA sequence.

EL624074; SV 1; linear; mRNA; EST; PLN; 436 BP.
EL624074;
EST1580 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067C051, mRNA sequence.

EL624075; SV 1; linear; mRNA; EST; PLN; 782 BP.
EL624075;
EST1581 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067C071, mRNA sequence.

EL624076; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL624076;
EST1582 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067C081, mRNA sequence.

EL624077; SV 1; linear; mRNA; EST; PLN; 816 BP.
EL624077;
EST1583 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067C111, mRNA sequence.

EL624078; SV 1; linear; mRNA; EST; PLN; 746 BP.
EL624078;
EST1584 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067D011, mRNA sequence.

EL624079; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL624079;
EST1585 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067D071, mRNA sequence.

EL624080; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL624080;
EST1586 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067D081, mRNA sequence.

EL624081; SV 1; linear; mRNA; EST; PLN; 642 BP.
EL624081;
EST1587 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067E011, mRNA sequence.

EL624082; SV 1; linear; mRNA; EST; PLN; 793 BP.
EL624082;
EST1588 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067E031, mRNA sequence.

EL624083; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL624083;
EST1589 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067E051, mRNA sequence.

EL624084; SV 1; linear; mRNA; EST; PLN; 661 BP.
EL624084;
EST1590 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067F011, mRNA sequence.

EL624085; SV 1; linear; mRNA; EST; PLN; 838 BP.
EL624085;
EST1591 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067F021, mRNA sequence.

EL624086; SV 1; linear; mRNA; EST; PLN; 769 BP.
EL624086;
EST1592 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067F071, mRNA sequence.

EL624087; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL624087;
EST1593 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067F081, mRNA sequence.

EL624088; SV 1; linear; mRNA; EST; PLN; 777 BP.
EL624088;
EST1594 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067F091, mRNA sequence.

EL624089; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL624089;
EST1595 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067G061, mRNA sequence.

EL624090; SV 1; linear; mRNA; EST; PLN; 414 BP.
EL624090;
EST1596 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067G091, mRNA sequence.

EL624091; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL624091;
EST1597 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067H011, mRNA sequence.

EL624092; SV 1; linear; mRNA; EST; PLN; 591 BP.
EL624092;
EST1598 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067H021, mRNA sequence.

EL624093; SV 1; linear; mRNA; EST; PLN; 390 BP.
EL624093;
EST1599 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067H031, mRNA sequence.

EL624094; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL624094;
EST1600 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B067H091, mRNA sequence.

EL624095; SV 1; linear; mRNA; EST; PLN; 484 BP.
EL624095;
EST1601 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068A011, mRNA sequence.

EL624096; SV 1; linear; mRNA; EST; PLN; 471 BP.
EL624096;
EST1602 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068A081, mRNA sequence.

EL624097; SV 1; linear; mRNA; EST; PLN; 654 BP.
EL624097;
EST1603 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068A091, mRNA sequence.

EL624098; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL624098;
EST1604 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068A101, mRNA sequence.

EL624099; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL624099;
EST1605 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068A121, mRNA sequence.

EL624100; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL624100;
EST1606 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068B011, mRNA sequence.

EL624101; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL624101;
EST1607 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068B051, mRNA sequence.

EL624102; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL624102;
EST1608 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068B081, mRNA sequence.

EL624103; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL624103;
EST1609 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068B121, mRNA sequence.

EL624104; SV 1; linear; mRNA; EST; PLN; 431 BP.
EL624104;
EST1610 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068C041, mRNA sequence.

EL624105; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL624105;
EST1611 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068C061, mRNA sequence.

EL624106; SV 1; linear; mRNA; EST; PLN; 659 BP.
EL624106;
EST1612 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068D031, mRNA sequence.

EL624107; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL624107;
EST1613 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068D061, mRNA sequence.

EL624108; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL624108;
EST1614 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068D081, mRNA sequence.

EL624109; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL624109;
EST1615 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068D091, mRNA sequence.

EL624110; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL624110;
EST1616 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068D111, mRNA sequence.

EL624111; SV 1; linear; mRNA; EST; PLN; 375 BP.
EL624111;
EST1617 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068D121, mRNA sequence.

EL624112; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL624112;
EST1618 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068E041, mRNA sequence.

EL624113; SV 1; linear; mRNA; EST; PLN; 501 BP.
EL624113;
EST1619 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068E051, mRNA sequence.

EL624114; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL624114;
EST1620 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068E071, mRNA sequence.

EL624115; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL624115;
EST1621 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068E121, mRNA sequence.

EL624116; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL624116;
EST1622 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068F061, mRNA sequence.

EL624117; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL624117;
EST1623 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068F081, mRNA sequence.

EL624118; SV 1; linear; mRNA; EST; PLN; 395 BP.
EL624118;
EST1624 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068F121, mRNA sequence.

EL624119; SV 1; linear; mRNA; EST; PLN; 674 BP.
EL624119;
EST1625 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068G041, mRNA sequence.

EL624120; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL624120;
EST1626 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068G061, mRNA sequence.

EL624121; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL624121;
EST1627 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068H011, mRNA sequence.

EL624122; SV 1; linear; mRNA; EST; PLN; 640 BP.
EL624122;
EST1628 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068H021, mRNA sequence.

EL624123; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL624123;
EST1629 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068H031, mRNA sequence.

EL624124; SV 1; linear; mRNA; EST; PLN; 621 BP.
EL624124;
EST1630 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068H041, mRNA sequence.

EL624125; SV 1; linear; mRNA; EST; PLN; 504 BP.
EL624125;
EST1631 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068H061, mRNA sequence.

EL624126; SV 1; linear; mRNA; EST; PLN; 507 BP.
EL624126;
EST1632 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B068H071, mRNA sequence.

EL624127; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL624127;
EST1633 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069A041, mRNA sequence.

EL624128; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL624128;
EST1634 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069A051, mRNA sequence.

EL624129; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL624129;
EST1635 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069A071, mRNA sequence.

EL624130; SV 1; linear; mRNA; EST; PLN; 304 BP.
EL624130;
EST1636 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069A121, mRNA sequence.

EL624131; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL624131;
EST1637 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069B061, mRNA sequence.

EL624132; SV 1; linear; mRNA; EST; PLN; 807 BP.
EL624132;
EST1638 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069B071, mRNA sequence.

EL624133; SV 1; linear; mRNA; EST; PLN; 815 BP.
EL624133;
EST1639 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069B101, mRNA sequence.

EL624134; SV 1; linear; mRNA; EST; PLN; 961 BP.
EL624134;
EST1640 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069B111, mRNA sequence.

EL624135; SV 1; linear; mRNA; EST; PLN; 890 BP.
EL624135;
EST1641 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069B121, mRNA sequence.

EL624136; SV 1; linear; mRNA; EST; PLN; 661 BP.
EL624136;
EST1642 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069C011, mRNA sequence.

EL624137; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL624137;
EST1643 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069C021, mRNA sequence.

EL624138; SV 1; linear; mRNA; EST; PLN; 758 BP.
EL624138;
EST1644 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069C061, mRNA sequence.

EL624139; SV 1; linear; mRNA; EST; PLN; 844 BP.
EL624139;
EST1645 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069C101, mRNA sequence.

EL624140; SV 1; linear; mRNA; EST; PLN; 865 BP.
EL624140;
EST1646 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069C111, mRNA sequence.

EL624141; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL624141;
EST1647 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069D011, mRNA sequence.

EL624142; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL624142;
EST1648 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069D021, mRNA sequence.

EL624143; SV 1; linear; mRNA; EST; PLN; 802 BP.
EL624143;
EST1649 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069D061, mRNA sequence.

EL624144; SV 1; linear; mRNA; EST; PLN; 905 BP.
EL624144;
EST1650 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069E021, mRNA sequence.

EL624145; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL624145;
EST1651 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069E061, mRNA sequence.

EL624146; SV 1; linear; mRNA; EST; PLN; 807 BP.
EL624146;
EST1652 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069E071, mRNA sequence.

EL624147; SV 1; linear; mRNA; EST; PLN; 873 BP.
EL624147;
EST1653 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069E101, mRNA sequence.

EL624148; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL624148;
EST1654 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069E121, mRNA sequence.

EL624149; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL624149;
EST1655 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069F021, mRNA sequence.

EL624150; SV 1; linear; mRNA; EST; PLN; 831 BP.
EL624150;
EST1656 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069F031, mRNA sequence.

EL624151; SV 1; linear; mRNA; EST; PLN; 729 BP.
EL624151;
EST1657 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069F051, mRNA sequence.

EL624152; SV 1; linear; mRNA; EST; PLN; 780 BP.
EL624152;
EST1658 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069F061, mRNA sequence.

EL624153; SV 1; linear; mRNA; EST; PLN; 906 BP.
EL624153;
EST1659 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069F111, mRNA sequence.

EL624154; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL624154;
EST1660 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069F121, mRNA sequence.

EL624155; SV 1; linear; mRNA; EST; PLN; 887 BP.
EL624155;
EST1661 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069G031, mRNA sequence.

EL624156; SV 1; linear; mRNA; EST; PLN; 808 BP.
EL624156;
EST1662 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069G081, mRNA sequence.

EL624157; SV 1; linear; mRNA; EST; PLN; 867 BP.
EL624157;
EST1663 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069G101, mRNA sequence.

EL624158; SV 1; linear; mRNA; EST; PLN; 846 BP.
EL624158;
EST1664 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069H031, mRNA sequence.

EL624159; SV 1; linear; mRNA; EST; PLN; 780 BP.
EL624159;
EST1665 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069H061, mRNA sequence.

EL624160; SV 1; linear; mRNA; EST; PLN; 898 BP.
EL624160;
EST1666 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069H071, mRNA sequence.

EL624161; SV 1; linear; mRNA; EST; PLN; 817 BP.
EL624161;
EST1667 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069H091, mRNA sequence.

EL624162; SV 1; linear; mRNA; EST; PLN; 855 BP.
EL624162;
EST1668 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069H101, mRNA sequence.

EL624163; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL624163;
EST1669 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B069H111, mRNA sequence.

EL624164; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL624164;
EST1670 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070A021, mRNA sequence.

EL624165; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL624165;
EST1671 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070A061, mRNA sequence.

EL624166; SV 1; linear; mRNA; EST; PLN; 828 BP.
EL624166;
EST1672 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070A081, mRNA sequence.

EL624167; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL624167;
EST1673 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070B011, mRNA sequence.

EL624168; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL624168;
EST1674 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070B061, mRNA sequence.

EL624169; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL624169;
EST1675 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070B101, mRNA sequence.

EL624170; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL624170;
EST1676 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070B121, mRNA sequence.

EL624171; SV 1; linear; mRNA; EST; PLN; 820 BP.
EL624171;
EST1677 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070C031, mRNA sequence.

EL624172; SV 1; linear; mRNA; EST; PLN; 867 BP.
EL624172;
EST1678 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070C051, mRNA sequence.

EL624173; SV 1; linear; mRNA; EST; PLN; 831 BP.
EL624173;
EST1679 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070C061, mRNA sequence.

EL624174; SV 1; linear; mRNA; EST; PLN; 879 BP.
EL624174;
EST1680 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070C071, mRNA sequence.

EL624175; SV 1; linear; mRNA; EST; PLN; 850 BP.
EL624175;
EST1681 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070C081, mRNA sequence.

EL624176; SV 1; linear; mRNA; EST; PLN; 868 BP.
EL624176;
EST1682 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070D121, mRNA sequence.

EL624177; SV 1; linear; mRNA; EST; PLN; 832 BP.
EL624177;
EST1683 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070E041, mRNA sequence.

EL624178; SV 1; linear; mRNA; EST; PLN; 824 BP.
EL624178;
EST1684 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070E051, mRNA sequence.

EL624179; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL624179;
EST1685 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070E091, mRNA sequence.

EL624180; SV 1; linear; mRNA; EST; PLN; 741 BP.
EL624180;
EST1686 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070E121, mRNA sequence.

EL624181; SV 1; linear; mRNA; EST; PLN; 741 BP.
EL624181;
EST1687 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070F021, mRNA sequence.

EL624182; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL624182;
EST1688 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070F061, mRNA sequence.

EL624183; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL624183;
EST1689 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070F091, mRNA sequence.

EL624184; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL624184;
EST1690 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070G021, mRNA sequence.

EL624185; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL624185;
EST1691 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070G031, mRNA sequence.

EL624186; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL624186;
EST1692 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070G051, mRNA sequence.

EL624187; SV 1; linear; mRNA; EST; PLN; 907 BP.
EL624187;
EST1693 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070G071, mRNA sequence.

EL624188; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL624188;
EST1694 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070H051, mRNA sequence.

EL624189; SV 1; linear; mRNA; EST; PLN; 873 BP.
EL624189;
EST1695 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070H061, mRNA sequence.

EL624190; SV 1; linear; mRNA; EST; PLN; 899 BP.
EL624190;
EST1696 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070H071, mRNA sequence.

EL624191; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL624191;
EST1697 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070H081, mRNA sequence.

EL624192; SV 1; linear; mRNA; EST; PLN; 889 BP.
EL624192;
EST1698 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B070H121, mRNA sequence.

EL624193; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL624193;
EST1699 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071A031, mRNA sequence.

EL624194; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL624194;
EST1700 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071A041, mRNA sequence.

EL624195; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL624195;
EST1701 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071A091, mRNA sequence.

EL624196; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL624196;
EST1702 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071B061, mRNA sequence.

EL624197; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL624197;
EST1703 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071B071, mRNA sequence.

EL624198; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL624198;
EST1704 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071B081, mRNA sequence.

EL624199; SV 1; linear; mRNA; EST; PLN; 683 BP.
EL624199;
EST1705 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071B101, mRNA sequence.

EL624200; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL624200;
EST1706 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071B111, mRNA sequence.

EL624201; SV 1; linear; mRNA; EST; PLN; 474 BP.
EL624201;
EST1707 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071C021, mRNA sequence.

EL624202; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL624202;
EST1708 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071C031, mRNA sequence.

EL624203; SV 1; linear; mRNA; EST; PLN; 611 BP.
EL624203;
EST1709 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071D021, mRNA sequence.

EL624204; SV 1; linear; mRNA; EST; PLN; 792 BP.
EL624204;
EST1710 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071D051, mRNA sequence.

EL624205; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL624205;
EST1711 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071D061, mRNA sequence.

EL624206; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL624206;
EST1712 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071D111, mRNA sequence.

EL624207; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL624207;
EST1713 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071E021, mRNA sequence.

EL624208; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL624208;
EST1714 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071E081, mRNA sequence.

EL624209; SV 1; linear; mRNA; EST; PLN; 670 BP.
EL624209;
EST1715 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071E101, mRNA sequence.

EL624210; SV 1; linear; mRNA; EST; PLN; 575 BP.
EL624210;
EST1716 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071E111, mRNA sequence.

EL624211; SV 1; linear; mRNA; EST; PLN; 660 BP.
EL624211;
EST1717 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071F021, mRNA sequence.

EL624212; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL624212;
EST1718 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071F031, mRNA sequence.

EL624213; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL624213;
EST1719 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071F111, mRNA sequence.

EL624214; SV 1; linear; mRNA; EST; PLN; 580 BP.
EL624214;
EST1720 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071G011, mRNA sequence.

EL624215; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL624215;
EST1721 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071G021, mRNA sequence.

EL624216; SV 1; linear; mRNA; EST; PLN; 469 BP.
EL624216;
EST1722 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071G051, mRNA sequence.

EL624217; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL624217;
EST1723 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071G061, mRNA sequence.

EL624218; SV 1; linear; mRNA; EST; PLN; 670 BP.
EL624218;
EST1724 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071G091, mRNA sequence.

EL624219; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL624219;
EST1725 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071G111, mRNA sequence.

EL624220; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL624220;
EST1726 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071G121, mRNA sequence.

EL624221; SV 1; linear; mRNA; EST; PLN; 492 BP.
EL624221;
EST1727 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071H021, mRNA sequence.

EL624222; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL624222;
EST1728 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071H031, mRNA sequence.

EL624223; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL624223;
EST1729 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071H081, mRNA sequence.

EL624224; SV 1; linear; mRNA; EST; PLN; 723 BP.
EL624224;
EST1730 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071H091, mRNA sequence.

EL624225; SV 1; linear; mRNA; EST; PLN; 679 BP.
EL624225;
EST1731 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071H101, mRNA sequence.

EL624226; SV 1; linear; mRNA; EST; PLN; 533 BP.
EL624226;
EST1732 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B071H121, mRNA sequence.

EL624227; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL624227;
EST1733 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072A051, mRNA sequence.

EL624228; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL624228;
EST1734 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072A061, mRNA sequence.

EL624229; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL624229;
EST1735 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072D011, mRNA sequence.

EL624230; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL624230;
EST1736 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072D111, mRNA sequence.

EL624231; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL624231;
EST1737 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072E011, mRNA sequence.

EL624232; SV 1; linear; mRNA; EST; PLN; 591 BP.
EL624232;
EST1738 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072E021, mRNA sequence.

EL624233; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL624233;
EST1739 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072E051, mRNA sequence.

EL624234; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL624234;
EST1740 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072G061, mRNA sequence.

EL624235; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL624235;
EST1741 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072G071, mRNA sequence.

EL624236; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL624236;
EST1742 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072G091, mRNA sequence.

EL624237; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL624237;
EST1743 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B072H091, mRNA sequence.

EL624238; SV 1; linear; mRNA; EST; PLN; 654 BP.
EL624238;
EST1744 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073A021, mRNA sequence.

EL624239; SV 1; linear; mRNA; EST; PLN; 617 BP.
EL624239;
EST1745 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073A071, mRNA sequence.

EL624240; SV 1; linear; mRNA; EST; PLN; 753 BP.
EL624240;
EST1746 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073A081, mRNA sequence.

EL624241; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL624241;
EST1747 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073A121, mRNA sequence.

EL624242; SV 1; linear; mRNA; EST; PLN; 525 BP.
EL624242;
EST1748 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073B011, mRNA sequence.

EL624243; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL624243;
EST1749 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073B041, mRNA sequence.

EL624244; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL624244;
EST1750 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073B081, mRNA sequence.

EL624245; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL624245;
EST1751 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073B101, mRNA sequence.

EL624246; SV 1; linear; mRNA; EST; PLN; 741 BP.
EL624246;
EST1752 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073C071, mRNA sequence.

EL624247; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL624247;
EST1753 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073D011, mRNA sequence.

EL624248; SV 1; linear; mRNA; EST; PLN; 720 BP.
EL624248;
EST1754 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073D031, mRNA sequence.

EL624249; SV 1; linear; mRNA; EST; PLN; 780 BP.
EL624249;
EST1755 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073D061, mRNA sequence.

EL624250; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL624250;
EST1756 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073D101, mRNA sequence.

EL624251; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL624251;
EST1757 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073E051, mRNA sequence.

EL624252; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL624252;
EST1758 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073E121, mRNA sequence.

EL624253; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL624253;
EST1759 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073G011, mRNA sequence.

EL624254; SV 1; linear; mRNA; EST; PLN; 577 BP.
EL624254;
EST1760 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073G051, mRNA sequence.

EL624255; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL624255;
EST1761 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073H011, mRNA sequence.

EL624256; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL624256;
EST1762 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073H071, mRNA sequence.

EL624257; SV 1; linear; mRNA; EST; PLN; 587 BP.
EL624257;
EST1763 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B073H101, mRNA sequence.

EL624258; SV 1; linear; mRNA; EST; PLN; 643 BP.
EL624258;
EST1764 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074A081, mRNA sequence.

EL624259; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL624259;
EST1765 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074B061, mRNA sequence.

EL624260; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL624260;
EST1766 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074B091, mRNA sequence.

EL624261; SV 1; linear; mRNA; EST; PLN; 868 BP.
EL624261;
EST1767 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074B101, mRNA sequence.

EL624262; SV 1; linear; mRNA; EST; PLN; 850 BP.
EL624262;
EST1768 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074B111, mRNA sequence.

EL624263; SV 1; linear; mRNA; EST; PLN; 550 BP.
EL624263;
EST1769 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074D091, mRNA sequence.

EL624264; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL624264;
EST1770 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074E101, mRNA sequence.

EL624265; SV 1; linear; mRNA; EST; PLN; 777 BP.
EL624265;
EST1771 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074F011, mRNA sequence.

EL624266; SV 1; linear; mRNA; EST; PLN; 831 BP.
EL624266;
EST1772 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074F091, mRNA sequence.

EL624267; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL624267;
EST1773 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074G101, mRNA sequence.

EL624268; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL624268;
EST1774 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074H051, mRNA sequence.

EL624269; SV 1; linear; mRNA; EST; PLN; 836 BP.
EL624269;
EST1775 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B074H101, mRNA sequence.

EL624270; SV 1; linear; mRNA; EST; PLN; 424 BP.
EL624270;
EST1776 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075A041, mRNA sequence.

EL624271; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL624271;
EST1777 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075A101, mRNA sequence.

EL624272; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL624272;
EST1778 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075A111, mRNA sequence.

EL624273; SV 1; linear; mRNA; EST; PLN; 370 BP.
EL624273;
EST1779 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075B021, mRNA sequence.

EL624274; SV 1; linear; mRNA; EST; PLN; 279 BP.
EL624274;
EST1780 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075B041, mRNA sequence.

EL624275; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL624275;
EST1781 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075B061, mRNA sequence.

EL624276; SV 1; linear; mRNA; EST; PLN; 405 BP.
EL624276;
EST1782 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075B091, mRNA sequence.

EL624277; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL624277;
EST1783 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075B121, mRNA sequence.

EL624278; SV 1; linear; mRNA; EST; PLN; 419 BP.
EL624278;
EST1784 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075C011, mRNA sequence.

EL624279; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL624279;
EST1785 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075C041, mRNA sequence.

EL624280; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL624280;
EST1786 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075C051, mRNA sequence.

EL624281; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL624281;
EST1787 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075C071, mRNA sequence.

EL624282; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL624282;
EST1788 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075C121, mRNA sequence.

EL624283; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL624283;
EST1789 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075D051, mRNA sequence.

EL624284; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL624284;
EST1790 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075D071, mRNA sequence.

EL624285; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL624285;
EST1791 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075D091, mRNA sequence.

EL624286; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL624286;
EST1792 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075E021, mRNA sequence.

EL624287; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL624287;
EST1793 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075E051, mRNA sequence.

EL624288; SV 1; linear; mRNA; EST; PLN; 550 BP.
EL624288;
EST1794 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075E061, mRNA sequence.

EL624289; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL624289;
EST1795 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075E071, mRNA sequence.

EL624290; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL624290;
EST1796 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075E081, mRNA sequence.

EL624291; SV 1; linear; mRNA; EST; PLN; 390 BP.
EL624291;
EST1797 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075F021, mRNA sequence.

EL624292; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL624292;
EST1798 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075F071, mRNA sequence.

EL624293; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL624293;
EST1799 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075F111, mRNA sequence.

EL624294; SV 1; linear; mRNA; EST; PLN; 396 BP.
EL624294;
EST1800 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075G011, mRNA sequence.

EL624295; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL624295;
EST1801 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075G111, mRNA sequence.

EL624296; SV 1; linear; mRNA; EST; PLN; 357 BP.
EL624296;
EST1802 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075H041, mRNA sequence.

EL624297; SV 1; linear; mRNA; EST; PLN; 512 BP.
EL624297;
EST1803 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075H081, mRNA sequence.

EL624298; SV 1; linear; mRNA; EST; PLN; 399 BP.
EL624298;
EST1804 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075H091, mRNA sequence.

EL624299; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL624299;
EST1805 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B075H121, mRNA sequence.

EL624300; SV 1; linear; mRNA; EST; PLN; 656 BP.
EL624300;
EST1806 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076A011, mRNA sequence.

EL624301; SV 1; linear; mRNA; EST; PLN; 690 BP.
EL624301;
EST1807 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076A071, mRNA sequence.

EL624302; SV 1; linear; mRNA; EST; PLN; 773 BP.
EL624302;
EST1808 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076A081, mRNA sequence.

EL624303; SV 1; linear; mRNA; EST; PLN; 719 BP.
EL624303;
EST1809 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076B021, mRNA sequence.

EL624304; SV 1; linear; mRNA; EST; PLN; 795 BP.
EL624304;
EST1810 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076B031, mRNA sequence.

EL624305; SV 1; linear; mRNA; EST; PLN; 815 BP.
EL624305;
EST1811 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076B051, mRNA sequence.

EL624306; SV 1; linear; mRNA; EST; PLN; 866 BP.
EL624306;
EST1812 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076B061, mRNA sequence.

EL624307; SV 1; linear; mRNA; EST; PLN; 741 BP.
EL624307;
EST1813 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076B071, mRNA sequence.

EL624308; SV 1; linear; mRNA; EST; PLN; 736 BP.
EL624308;
EST1814 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076B081, mRNA sequence.

EL624309; SV 1; linear; mRNA; EST; PLN; 836 BP.
EL624309;
EST1815 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076B121, mRNA sequence.

EL624310; SV 1; linear; mRNA; EST; PLN; 778 BP.
EL624310;
EST1816 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076C041, mRNA sequence.

EL624311; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL624311;
EST1817 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076C081, mRNA sequence.

EL624312; SV 1; linear; mRNA; EST; PLN; 811 BP.
EL624312;
EST1818 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076C111, mRNA sequence.

EL624313; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL624313;
EST1819 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076D011, mRNA sequence.

EL624314; SV 1; linear; mRNA; EST; PLN; 835 BP.
EL624314;
EST1820 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076D031, mRNA sequence.

EL624315; SV 1; linear; mRNA; EST; PLN; 855 BP.
EL624315;
EST1821 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076D051, mRNA sequence.

EL624316; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL624316;
EST1822 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076D121, mRNA sequence.

EL624317; SV 1; linear; mRNA; EST; PLN; 911 BP.
EL624317;
EST1823 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076E061, mRNA sequence.

EL624318; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL624318;
EST1824 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076E081, mRNA sequence.

EL624319; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL624319;
EST1825 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076F011, mRNA sequence.

EL624320; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL624320;
EST1826 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076F051, mRNA sequence.

EL624321; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL624321;
EST1827 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076G011, mRNA sequence.

EL624322; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL624322;
EST1828 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076G021, mRNA sequence.

EL624323; SV 1; linear; mRNA; EST; PLN; 790 BP.
EL624323;
EST1829 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076G041, mRNA sequence.

EL624324; SV 1; linear; mRNA; EST; PLN; 841 BP.
EL624324;
EST1830 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076G051, mRNA sequence.

EL624325; SV 1; linear; mRNA; EST; PLN; 737 BP.
EL624325;
EST1831 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076G071, mRNA sequence.

EL624326; SV 1; linear; mRNA; EST; PLN; 743 BP.
EL624326;
EST1832 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076G081, mRNA sequence.

EL624327; SV 1; linear; mRNA; EST; PLN; 830 BP.
EL624327;
EST1833 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076H031, mRNA sequence.

EL624328; SV 1; linear; mRNA; EST; PLN; 841 BP.
EL624328;
EST1834 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076H071, mRNA sequence.

EL624329; SV 1; linear; mRNA; EST; PLN; 823 BP.
EL624329;
EST1835 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B076H111, mRNA sequence.

EL624330; SV 1; linear; mRNA; EST; PLN; 723 BP.
EL624330;
EST1836 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077A031, mRNA sequence.

EL624331; SV 1; linear; mRNA; EST; PLN; 857 BP.
EL624331;
EST1837 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077A061, mRNA sequence.

EL624332; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL624332;
EST1838 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077A091, mRNA sequence.

EL624333; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL624333;
EST1839 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077A111, mRNA sequence.

EL624334; SV 1; linear; mRNA; EST; PLN; 876 BP.
EL624334;
EST1840 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077B021, mRNA sequence.

EL624335; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL624335;
EST1841 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077B031, mRNA sequence.

EL624336; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL624336;
EST1842 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077B091, mRNA sequence.

EL624337; SV 1; linear; mRNA; EST; PLN; 883 BP.
EL624337;
EST1843 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077B101, mRNA sequence.

EL624338; SV 1; linear; mRNA; EST; PLN; 790 BP.
EL624338;
EST1844 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077B111, mRNA sequence.

EL624339; SV 1; linear; mRNA; EST; PLN; 801 BP.
EL624339;
EST1845 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077C021, mRNA sequence.

EL624340; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL624340;
EST1846 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077C031, mRNA sequence.

EL624341; SV 1; linear; mRNA; EST; PLN; 775 BP.
EL624341;
EST1847 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077C041, mRNA sequence.

EL624342; SV 1; linear; mRNA; EST; PLN; 872 BP.
EL624342;
EST1848 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077C061, mRNA sequence.

EL624343; SV 1; linear; mRNA; EST; PLN; 898 BP.
EL624343;
EST1849 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077C091, mRNA sequence.

EL624344; SV 1; linear; mRNA; EST; PLN; 892 BP.
EL624344;
EST1850 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077C101, mRNA sequence.

EL624345; SV 1; linear; mRNA; EST; PLN; 840 BP.
EL624345;
EST1851 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077D071, mRNA sequence.

EL624346; SV 1; linear; mRNA; EST; PLN; 860 BP.
EL624346;
EST1852 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077D081, mRNA sequence.

EL624347; SV 1; linear; mRNA; EST; PLN; 891 BP.
EL624347;
EST1853 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077D091, mRNA sequence.

EL624348; SV 1; linear; mRNA; EST; PLN; 887 BP.
EL624348;
EST1854 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077D101, mRNA sequence.

EL624349; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL624349;
EST1855 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077E021, mRNA sequence.

EL624350; SV 1; linear; mRNA; EST; PLN; 567 BP.
EL624350;
EST1856 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077E051, mRNA sequence.

EL624351; SV 1; linear; mRNA; EST; PLN; 847 BP.
EL624351;
EST1857 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077E091, mRNA sequence.

EL624352; SV 1; linear; mRNA; EST; PLN; 728 BP.
EL624352;
EST1858 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077E111, mRNA sequence.

EL624353; SV 1; linear; mRNA; EST; PLN; 871 BP.
EL624353;
EST1859 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077F021, mRNA sequence.

EL624354; SV 1; linear; mRNA; EST; PLN; 830 BP.
EL624354;
EST1860 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077F061, mRNA sequence.

EL624355; SV 1; linear; mRNA; EST; PLN; 873 BP.
EL624355;
EST1861 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077F081, mRNA sequence.

EL624356; SV 1; linear; mRNA; EST; PLN; 863 BP.
EL624356;
EST1862 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077F091, mRNA sequence.

EL624357; SV 1; linear; mRNA; EST; PLN; 754 BP.
EL624357;
EST1863 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077F111, mRNA sequence.

EL624358; SV 1; linear; mRNA; EST; PLN; 718 BP.
EL624358;
EST1864 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077G061, mRNA sequence.

EL624359; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL624359;
EST1865 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077H041, mRNA sequence.

EL624360; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL624360;
EST1866 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077H051, mRNA sequence.

EL624361; SV 1; linear; mRNA; EST; PLN; 877 BP.
EL624361;
EST1867 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077H061, mRNA sequence.

EL624362; SV 1; linear; mRNA; EST; PLN; 840 BP.
EL624362;
EST1868 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077H081, mRNA sequence.

EL624363; SV 1; linear; mRNA; EST; PLN; 955 BP.
EL624363;
EST1869 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B077H091, mRNA sequence.

EL624364; SV 1; linear; mRNA; EST; PLN; 669 BP.
EL624364;
EST1870 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078A071, mRNA sequence.

EL624365; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL624365;
EST1871 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078A101, mRNA sequence.

EL624366; SV 1; linear; mRNA; EST; PLN; 836 BP.
EL624366;
EST1872 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078A111, mRNA sequence.

EL624367; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL624367;
EST1873 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078B011, mRNA sequence.

EL624368; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL624368;
EST1874 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078B031, mRNA sequence.

EL624369; SV 1; linear; mRNA; EST; PLN; 856 BP.
EL624369;
EST1875 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078B061, mRNA sequence.

EL624370; SV 1; linear; mRNA; EST; PLN; 795 BP.
EL624370;
EST1876 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078B071, mRNA sequence.

EL624371; SV 1; linear; mRNA; EST; PLN; 786 BP.
EL624371;
EST1877 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078C011, mRNA sequence.

EL624372; SV 1; linear; mRNA; EST; PLN; 818 BP.
EL624372;
EST1878 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078C031, mRNA sequence.

EL624373; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL624373;
EST1879 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078C061, mRNA sequence.

EL624374; SV 1; linear; mRNA; EST; PLN; 793 BP.
EL624374;
EST1880 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078C091, mRNA sequence.

EL624375; SV 1; linear; mRNA; EST; PLN; 758 BP.
EL624375;
EST1881 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078C111, mRNA sequence.

EL624376; SV 1; linear; mRNA; EST; PLN; 720 BP.
EL624376;
EST1882 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078D011, mRNA sequence.

EL624377; SV 1; linear; mRNA; EST; PLN; 805 BP.
EL624377;
EST1883 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078D041, mRNA sequence.

EL624378; SV 1; linear; mRNA; EST; PLN; 781 BP.
EL624378;
EST1884 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078D061, mRNA sequence.

EL624379; SV 1; linear; mRNA; EST; PLN; 771 BP.
EL624379;
EST1885 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078D111, mRNA sequence.

EL624380; SV 1; linear; mRNA; EST; PLN; 252 BP.
EL624380;
EST1886 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078E011, mRNA sequence.

EL624381; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL624381;
EST1887 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078E091, mRNA sequence.

EL624382; SV 1; linear; mRNA; EST; PLN; 645 BP.
EL624382;
EST1888 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078F031, mRNA sequence.

EL624383; SV 1; linear; mRNA; EST; PLN; 867 BP.
EL624383;
EST1889 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078F041, mRNA sequence.

EL624384; SV 1; linear; mRNA; EST; PLN; 781 BP.
EL624384;
EST1890 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078F101, mRNA sequence.

EL624385; SV 1; linear; mRNA; EST; PLN; 683 BP.
EL624385;
EST1891 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078F121, mRNA sequence.

EL624386; SV 1; linear; mRNA; EST; PLN; 878 BP.
EL624386;
EST1892 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078G051, mRNA sequence.

EL624387; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL624387;
EST1893 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078G071, mRNA sequence.

EL624388; SV 1; linear; mRNA; EST; PLN; 648 BP.
EL624388;
EST1894 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078G081, mRNA sequence.

EL624389; SV 1; linear; mRNA; EST; PLN; 831 BP.
EL624389;
EST1895 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078G101, mRNA sequence.

EL624390; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL624390;
EST1896 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078H031, mRNA sequence.

EL624391; SV 1; linear; mRNA; EST; PLN; 791 BP.
EL624391;
EST1897 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B078H091, mRNA sequence.

EL624392; SV 1; linear; mRNA; EST; PLN; 637 BP.
EL624392;
EST1898 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079A041, mRNA sequence.

EL624393; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL624393;
EST1899 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079A061, mRNA sequence.

EL624394; SV 1; linear; mRNA; EST; PLN; 602 BP.
EL624394;
EST1900 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079A071, mRNA sequence.

EL624395; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL624395;
EST1901 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079A081, mRNA sequence.

EL624396; SV 1; linear; mRNA; EST; PLN; 411 BP.
EL624396;
EST1902 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079B011, mRNA sequence.

EL624397; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL624397;
EST1903 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079B071, mRNA sequence.

EL624398; SV 1; linear; mRNA; EST; PLN; 383 BP.
EL624398;
EST1904 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079B101, mRNA sequence.

EL624399; SV 1; linear; mRNA; EST; PLN; 506 BP.
EL624399;
EST1905 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079B121, mRNA sequence.

EL624400; SV 1; linear; mRNA; EST; PLN; 525 BP.
EL624400;
EST1906 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079C011, mRNA sequence.

EL624401; SV 1; linear; mRNA; EST; PLN; 659 BP.
EL624401;
EST1907 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079C031, mRNA sequence.

EL624402; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL624402;
EST1908 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079C071, mRNA sequence.

EL624403; SV 1; linear; mRNA; EST; PLN; 617 BP.
EL624403;
EST1909 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079C081, mRNA sequence.

EL624404; SV 1; linear; mRNA; EST; PLN; 426 BP.
EL624404;
EST1910 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079C091, mRNA sequence.

EL624405; SV 1; linear; mRNA; EST; PLN; 371 BP.
EL624405;
EST1911 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079C101, mRNA sequence.

EL624406; SV 1; linear; mRNA; EST; PLN; 611 BP.
EL624406;
EST1912 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079C111, mRNA sequence.

EL624407; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL624407;
EST1913 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079D021, mRNA sequence.

EL624408; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL624408;
EST1914 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079D031, mRNA sequence.

EL624409; SV 1; linear; mRNA; EST; PLN; 603 BP.
EL624409;
EST1915 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079D061, mRNA sequence.

EL624410; SV 1; linear; mRNA; EST; PLN; 623 BP.
EL624410;
EST1916 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079E031, mRNA sequence.

EL624411; SV 1; linear; mRNA; EST; PLN; 716 BP.
EL624411;
EST1917 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079E041, mRNA sequence.

EL624412; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL624412;
EST1918 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079E051, mRNA sequence.

EL624413; SV 1; linear; mRNA; EST; PLN; 587 BP.
EL624413;
EST1919 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079E061, mRNA sequence.

EL624414; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL624414;
EST1920 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079E101, mRNA sequence.

EL624415; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL624415;
EST1921 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079E121, mRNA sequence.

EL624416; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL624416;
EST1922 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079F011, mRNA sequence.

EL624417; SV 1; linear; mRNA; EST; PLN; 575 BP.
EL624417;
EST1923 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079F031, mRNA sequence.

EL624418; SV 1; linear; mRNA; EST; PLN; 533 BP.
EL624418;
EST1924 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079F051, mRNA sequence.

EL624419; SV 1; linear; mRNA; EST; PLN; 428 BP.
EL624419;
EST1925 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079F091, mRNA sequence.

EL624420; SV 1; linear; mRNA; EST; PLN; 512 BP.
EL624420;
EST1926 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079F121, mRNA sequence.

EL624421; SV 1; linear; mRNA; EST; PLN; 373 BP.
EL624421;
EST1927 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079G011, mRNA sequence.

EL624422; SV 1; linear; mRNA; EST; PLN; 568 BP.
EL624422;
EST1928 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079G051, mRNA sequence.

EL624423; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL624423;
EST1929 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079G061, mRNA sequence.

EL624424; SV 1; linear; mRNA; EST; PLN; 650 BP.
EL624424;
EST1930 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079G081, mRNA sequence.

EL624425; SV 1; linear; mRNA; EST; PLN; 419 BP.
EL624425;
EST1931 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079G091, mRNA sequence.

EL624426; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL624426;
EST1932 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079G101, mRNA sequence.

EL624427; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL624427;
EST1933 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079H041, mRNA sequence.

EL624428; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL624428;
EST1934 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079H071, mRNA sequence.

EL624429; SV 1; linear; mRNA; EST; PLN; 393 BP.
EL624429;
EST1935 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079H091, mRNA sequence.

EL624430; SV 1; linear; mRNA; EST; PLN; 357 BP.
EL624430;
EST1936 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B079H101, mRNA sequence.

EL624431; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL624431;
EST1937 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080A071, mRNA sequence.

EL624432; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL624432;
EST1938 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080A081, mRNA sequence.

EL624433; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL624433;
EST1939 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080A091, mRNA sequence.

EL624434; SV 1; linear; mRNA; EST; PLN; 498 BP.
EL624434;
EST1940 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080A121, mRNA sequence.

EL624435; SV 1; linear; mRNA; EST; PLN; 501 BP.
EL624435;
EST1941 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080B041, mRNA sequence.

EL624436; SV 1; linear; mRNA; EST; PLN; 429 BP.
EL624436;
EST1942 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080B051, mRNA sequence.

EL624437; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL624437;
EST1943 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080B081, mRNA sequence.

EL624438; SV 1; linear; mRNA; EST; PLN; 421 BP.
EL624438;
EST1944 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080C041, mRNA sequence.

EL624439; SV 1; linear; mRNA; EST; PLN; 320 BP.
EL624439;
EST1945 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080C061, mRNA sequence.

EL624440; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL624440;
EST1946 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080C091, mRNA sequence.

EL624441; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL624441;
EST1947 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080C121, mRNA sequence.

EL624442; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL624442;
EST1948 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080D011, mRNA sequence.

EL624443; SV 1; linear; mRNA; EST; PLN; 466 BP.
EL624443;
EST1949 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080D061, mRNA sequence.

EL624444; SV 1; linear; mRNA; EST; PLN; 450 BP.
EL624444;
EST1950 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080E041, mRNA sequence.

EL624445; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL624445;
EST1951 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080E051, mRNA sequence.

EL624446; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL624446;
EST1952 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080E111, mRNA sequence.

EL624447; SV 1; linear; mRNA; EST; PLN; 350 BP.
EL624447;
EST1953 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080F031, mRNA sequence.

EL624448; SV 1; linear; mRNA; EST; PLN; 385 BP.
EL624448;
EST1954 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080F051, mRNA sequence.

EL624449; SV 1; linear; mRNA; EST; PLN; 741 BP.
EL624449;
EST1955 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080F071, mRNA sequence.

EL624450; SV 1; linear; mRNA; EST; PLN; 835 BP.
EL624450;
EST1956 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080G021, mRNA sequence.

EL624451; SV 1; linear; mRNA; EST; PLN; 408 BP.
EL624451;
EST1957 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080G111, mRNA sequence.

EL624452; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL624452;
EST1958 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080H021, mRNA sequence.

EL624453; SV 1; linear; mRNA; EST; PLN; 406 BP.
EL624453;
EST1959 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080H031, mRNA sequence.

EL624454; SV 1; linear; mRNA; EST; PLN; 353 BP.
EL624454;
EST1960 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080H051, mRNA sequence.

EL624455; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL624455;
EST1961 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080H081, mRNA sequence.

EL624456; SV 1; linear; mRNA; EST; PLN; 533 BP.
EL624456;
EST1962 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B080H121, mRNA sequence.

EL624457; SV 1; linear; mRNA; EST; PLN; 831 BP.
EL624457;
EST1963 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081A011, mRNA sequence.

EL624458; SV 1; linear; mRNA; EST; PLN; 431 BP.
EL624458;
EST1964 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081A041, mRNA sequence.

EL624459; SV 1; linear; mRNA; EST; PLN; 647 BP.
EL624459;
EST1965 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081A081, mRNA sequence.

EL624460; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL624460;
EST1966 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081A101, mRNA sequence.

EL624461; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL624461;
EST1967 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081B011, mRNA sequence.

EL624462; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL624462;
EST1968 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081B021, mRNA sequence.

EL624463; SV 1; linear; mRNA; EST; PLN; 324 BP.
EL624463;
EST1969 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081B041, mRNA sequence.

EL624464; SV 1; linear; mRNA; EST; PLN; 396 BP.
EL624464;
EST1970 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081B061, mRNA sequence.

EL624465; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL624465;
EST1971 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081B081, mRNA sequence.

EL624466; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL624466;
EST1972 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081B121, mRNA sequence.

EL624467; SV 1; linear; mRNA; EST; PLN; 423 BP.
EL624467;
EST1973 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081C051, mRNA sequence.

EL624468; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL624468;
EST1974 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081C081, mRNA sequence.

EL624469; SV 1; linear; mRNA; EST; PLN; 819 BP.
EL624469;
EST1975 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081D021, mRNA sequence.

EL624470; SV 1; linear; mRNA; EST; PLN; 287 BP.
EL624470;
EST1976 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081D031, mRNA sequence.

EL624471; SV 1; linear; mRNA; EST; PLN; 432 BP.
EL624471;
EST1977 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081D051, mRNA sequence.

EL624472; SV 1; linear; mRNA; EST; PLN; 344 BP.
EL624472;
EST1978 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081D091, mRNA sequence.

EL624473; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL624473;
EST1979 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081D111, mRNA sequence.

EL624474; SV 1; linear; mRNA; EST; PLN; 652 BP.
EL624474;
EST1980 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081E021, mRNA sequence.

EL624475; SV 1; linear; mRNA; EST; PLN; 724 BP.
EL624475;
EST1981 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081E071, mRNA sequence.

EL624476; SV 1; linear; mRNA; EST; PLN; 714 BP.
EL624476;
EST1982 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081E081, mRNA sequence.

EL624477; SV 1; linear; mRNA; EST; PLN; 473 BP.
EL624477;
EST1983 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081E121, mRNA sequence.

EL624478; SV 1; linear; mRNA; EST; PLN; 362 BP.
EL624478;
EST1984 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081F061, mRNA sequence.

EL624479; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL624479;
EST1985 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081F071, mRNA sequence.

EL624480; SV 1; linear; mRNA; EST; PLN; 391 BP.
EL624480;
EST1986 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081F121, mRNA sequence.

EL624481; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL624481;
EST1987 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081G041, mRNA sequence.

EL624482; SV 1; linear; mRNA; EST; PLN; 600 BP.
EL624482;
EST1988 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081G081, mRNA sequence.

EL624483; SV 1; linear; mRNA; EST; PLN; 462 BP.
EL624483;
EST1989 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081G101, mRNA sequence.

EL624484; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL624484;
EST1990 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081H011, mRNA sequence.

EL624485; SV 1; linear; mRNA; EST; PLN; 301 BP.
EL624485;
EST1991 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081H101, mRNA sequence.

EL624486; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL624486;
EST1992 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B081H121, mRNA sequence.

EL624487; SV 1; linear; mRNA; EST; PLN; 372 BP.
EL624487;
EST1993 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B082A031, mRNA sequence.

EL624488; SV 1; linear; mRNA; EST; PLN; 494 BP.
EL624488;
EST1994 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B082A091, mRNA sequence.

EL624489; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL624489;
EST1995 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B082B071, mRNA sequence.

EL624490; SV 1; linear; mRNA; EST; PLN; 370 BP.
EL624490;
EST1996 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B082B091, mRNA sequence.

EL624491; SV 1; linear; mRNA; EST; PLN; 437 BP.
EL624491;
EST1997 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083A041, mRNA sequence.

EL624492; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL624492;
EST1998 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083A051, mRNA sequence.

EL624493; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL624493;
EST1999 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083A091, mRNA sequence.

EL624494; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL624494;
EST2000 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083B011, mRNA sequence.

EL624495; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL624495;
EST2001 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083B021, mRNA sequence.

EL624496; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL624496;
EST2002 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083C031, mRNA sequence.

EL624497; SV 1; linear; mRNA; EST; PLN; 359 BP.
EL624497;
EST2003 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083C041, mRNA sequence.

EL624498; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL624498;
EST2004 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083C061, mRNA sequence.

EL624499; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL624499;
EST2005 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083C111, mRNA sequence.

EL624500; SV 1; linear; mRNA; EST; PLN; 447 BP.
EL624500;
EST2006 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083C121, mRNA sequence.

EL624501; SV 1; linear; mRNA; EST; PLN; 503 BP.
EL624501;
EST2007 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083D071, mRNA sequence.

EL624502; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL624502;
EST2008 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083D091, mRNA sequence.

EL624503; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL624503;
EST2009 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083E031, mRNA sequence.

EL624504; SV 1; linear; mRNA; EST; PLN; 406 BP.
EL624504;
EST2010 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083G011, mRNA sequence.

EL624505; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL624505;
EST2011 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083G051, mRNA sequence.

EL624506; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL624506;
EST2012 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083G111, mRNA sequence.

EL624507; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL624507;
EST2013 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083H031, mRNA sequence.

EL624508; SV 1; linear; mRNA; EST; PLN; 501 BP.
EL624508;
EST2014 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083H071, mRNA sequence.

EL624509; SV 1; linear; mRNA; EST; PLN; 567 BP.
EL624509;
EST2015 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083H081, mRNA sequence.

EL624510; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL624510;
EST2016 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B083H111, mRNA sequence.

EL624511; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL624511;
EST2017 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084A011, mRNA sequence.

EL624512; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL624512;
EST2018 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084A051, mRNA sequence.

EL624513; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL624513;
EST2019 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084A061, mRNA sequence.

EL624514; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL624514;
EST2020 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084A081, mRNA sequence.

EL624515; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL624515;
EST2021 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084A091, mRNA sequence.

EL624516; SV 1; linear; mRNA; EST; PLN; 506 BP.
EL624516;
EST2022 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084A101, mRNA sequence.

EL624517; SV 1; linear; mRNA; EST; PLN; 662 BP.
EL624517;
EST2023 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084B011, mRNA sequence.

EL624518; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL624518;
EST2024 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084B061, mRNA sequence.

EL624519; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL624519;
EST2025 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084B071, mRNA sequence.

EL624520; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL624520;
EST2026 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084C011, mRNA sequence.

EL624521; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL624521;
EST2027 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084C031, mRNA sequence.

EL624522; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL624522;
EST2028 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084C051, mRNA sequence.

EL624523; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL624523;
EST2029 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084C061, mRNA sequence.

EL624524; SV 1; linear; mRNA; EST; PLN; 494 BP.
EL624524;
EST2030 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084C111, mRNA sequence.

EL624525; SV 1; linear; mRNA; EST; PLN; 367 BP.
EL624525;
EST2031 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084D051, mRNA sequence.

EL624526; SV 1; linear; mRNA; EST; PLN; 491 BP.
EL624526;
EST2032 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084D061, mRNA sequence.

EL624527; SV 1; linear; mRNA; EST; PLN; 577 BP.
EL624527;
EST2033 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084D121, mRNA sequence.

EL624528; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL624528;
EST2034 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084E041, mRNA sequence.

EL624529; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL624529;
EST2035 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084E121, mRNA sequence.

EL624530; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL624530;
EST2036 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084F011, mRNA sequence.

EL624531; SV 1; linear; mRNA; EST; PLN; 512 BP.
EL624531;
EST2037 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084F081, mRNA sequence.

EL624532; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL624532;
EST2038 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084G081, mRNA sequence.

EL624533; SV 1; linear; mRNA; EST; PLN; 525 BP.
EL624533;
EST2039 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084H011, mRNA sequence.

EL624534; SV 1; linear; mRNA; EST; PLN; 498 BP.
EL624534;
EST2040 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B084H041, mRNA sequence.

EL624535; SV 1; linear; mRNA; EST; PLN; 501 BP.
EL624535;
EST2041 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085A011, mRNA sequence.

EL624536; SV 1; linear; mRNA; EST; PLN; 622 BP.
EL624536;
EST2042 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085B011, mRNA sequence.

EL624537; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL624537;
EST2043 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085B021, mRNA sequence.

EL624538; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL624538;
EST2044 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085B111, mRNA sequence.

EL624539; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL624539;
EST2045 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085C061, mRNA sequence.

EL624540; SV 1; linear; mRNA; EST; PLN; 595 BP.
EL624540;
EST2046 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085C071, mRNA sequence.

EL624541; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL624541;
EST2047 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085C091, mRNA sequence.

EL624542; SV 1; linear; mRNA; EST; PLN; 849 BP.
EL624542;
EST2048 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085D011, mRNA sequence.

EL624543; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL624543;
EST2049 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085D041, mRNA sequence.

EL624544; SV 1; linear; mRNA; EST; PLN; 754 BP.
EL624544;
EST2050 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085D071, mRNA sequence.

EL624545; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL624545;
EST2051 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085D101, mRNA sequence.

EL624546; SV 1; linear; mRNA; EST; PLN; 750 BP.
EL624546;
EST2052 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085E011, mRNA sequence.

EL624547; SV 1; linear; mRNA; EST; PLN; 676 BP.
EL624547;
EST2053 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085E091, mRNA sequence.

EL624548; SV 1; linear; mRNA; EST; PLN; 651 BP.
EL624548;
EST2054 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085E111, mRNA sequence.

EL624549; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL624549;
EST2055 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085F031, mRNA sequence.

EL624550; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL624550;
EST2056 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085F051, mRNA sequence.

EL624551; SV 1; linear; mRNA; EST; PLN; 728 BP.
EL624551;
EST2057 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085G021, mRNA sequence.

EL624552; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL624552;
EST2058 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085G031, mRNA sequence.

EL624553; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL624553;
EST2059 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085G081, mRNA sequence.

EL624554; SV 1; linear; mRNA; EST; PLN; 611 BP.
EL624554;
EST2060 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085H011, mRNA sequence.

EL624555; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL624555;
EST2061 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B085H031, mRNA sequence.

EL624556; SV 1; linear; mRNA; EST; PLN; 575 BP.
EL624556;
EST2062 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086B071, mRNA sequence.

EL624557; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL624557;
EST2063 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086B081, mRNA sequence.

EL624558; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL624558;
EST2064 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086B091, mRNA sequence.

EL624559; SV 1; linear; mRNA; EST; PLN; 656 BP.
EL624559;
EST2065 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086C011, mRNA sequence.

EL624560; SV 1; linear; mRNA; EST; PLN; 525 BP.
EL624560;
EST2066 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086C061, mRNA sequence.

EL624561; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL624561;
EST2067 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086D061, mRNA sequence.

EL624562; SV 1; linear; mRNA; EST; PLN; 600 BP.
EL624562;
EST2068 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086D081, mRNA sequence.

EL624563; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL624563;
EST2069 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086D111, mRNA sequence.

EL624564; SV 1; linear; mRNA; EST; PLN; 627 BP.
EL624564;
EST2070 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086E091, mRNA sequence.

EL624565; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL624565;
EST2071 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086E101, mRNA sequence.

EL624566; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL624566;
EST2072 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086E111, mRNA sequence.

EL624567; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL624567;
EST2073 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086F071, mRNA sequence.

EL624568; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL624568;
EST2074 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086F101, mRNA sequence.

EL624569; SV 1; linear; mRNA; EST; PLN; 619 BP.
EL624569;
EST2075 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086G021, mRNA sequence.

EL624570; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL624570;
EST2076 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086G051, mRNA sequence.

EL624571; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL624571;
EST2077 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086G061, mRNA sequence.

EL624572; SV 1; linear; mRNA; EST; PLN; 354 BP.
EL624572;
EST2078 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086G111, mRNA sequence.

EL624573; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL624573;
EST2079 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086G121, mRNA sequence.

EL624574; SV 1; linear; mRNA; EST; PLN; 395 BP.
EL624574;
EST2080 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086H011, mRNA sequence.

EL624575; SV 1; linear; mRNA; EST; PLN; 430 BP.
EL624575;
EST2081 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086H021, mRNA sequence.

EL624576; SV 1; linear; mRNA; EST; PLN; 311 BP.
EL624576;
EST2082 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086H051, mRNA sequence.

EL624577; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL624577;
EST2083 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086H091, mRNA sequence.

EL624578; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL624578;
EST2084 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086H111, mRNA sequence.

EL624579; SV 1; linear; mRNA; EST; PLN; 534 BP.
EL624579;
EST2085 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B086H121, mRNA sequence.

EL624580; SV 1; linear; mRNA; EST; PLN; 320 BP.
EL624580;
EST2086 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087A021, mRNA sequence.

EL624581; SV 1; linear; mRNA; EST; PLN; 411 BP.
EL624581;
EST2087 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087A081, mRNA sequence.

EL624582; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL624582;
EST2088 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087B011, mRNA sequence.

EL624583; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL624583;
EST2089 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087B021, mRNA sequence.

EL624584; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL624584;
EST2090 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087B031, mRNA sequence.

EL624585; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL624585;
EST2091 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087B051, mRNA sequence.

EL624586; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL624586;
EST2092 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087B101, mRNA sequence.

EL624587; SV 1; linear; mRNA; EST; PLN; 472 BP.
EL624587;
EST2093 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087B111, mRNA sequence.

EL624588; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL624588;
EST2094 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087C011, mRNA sequence.

EL624589; SV 1; linear; mRNA; EST; PLN; 407 BP.
EL624589;
EST2095 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087D071, mRNA sequence.

EL624590; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL624590;
EST2096 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087D091, mRNA sequence.

EL624591; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL624591;
EST2097 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087D111, mRNA sequence.

EL624592; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL624592;
EST2098 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087E021, mRNA sequence.

EL624593; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL624593;
EST2099 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087E051, mRNA sequence.

EL624594; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL624594;
EST2100 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087E091, mRNA sequence.

EL624595; SV 1; linear; mRNA; EST; PLN; 623 BP.
EL624595;
EST2101 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087E111, mRNA sequence.

EL624596; SV 1; linear; mRNA; EST; PLN; 889 BP.
EL624596;
EST2102 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087F101, mRNA sequence.

EL624597; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL624597;
EST2103 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087F121, mRNA sequence.

EL624598; SV 1; linear; mRNA; EST; PLN; 792 BP.
EL624598;
EST2104 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087G051, mRNA sequence.

EL624599; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL624599;
EST2105 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087G091, mRNA sequence.

EL624600; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL624600;
EST2106 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087H011, mRNA sequence.

EL624601; SV 1; linear; mRNA; EST; PLN; 783 BP.
EL624601;
EST2107 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087H051, mRNA sequence.

EL624602; SV 1; linear; mRNA; EST; PLN; 785 BP.
EL624602;
EST2108 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087H061, mRNA sequence.

EL624603; SV 1; linear; mRNA; EST; PLN; 848 BP.
EL624603;
EST2109 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B087H121, mRNA sequence.

EL624604; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL624604;
EST2110 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088A041, mRNA sequence.

EL624605; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL624605;
EST2111 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088A081, mRNA sequence.

EL624606; SV 1; linear; mRNA; EST; PLN; 896 BP.
EL624606;
EST2112 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088A111, mRNA sequence.

EL624607; SV 1; linear; mRNA; EST; PLN; 674 BP.
EL624607;
EST2113 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088A121, mRNA sequence.

EL624608; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL624608;
EST2114 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088B021, mRNA sequence.

EL624609; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL624609;
EST2115 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088B031, mRNA sequence.

EL624610; SV 1; linear; mRNA; EST; PLN; 781 BP.
EL624610;
EST2116 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088B041, mRNA sequence.

EL624611; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL624611;
EST2117 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088B081, mRNA sequence.

EL624612; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL624612;
EST2118 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088B111, mRNA sequence.

EL624613; SV 1; linear; mRNA; EST; PLN; 663 BP.
EL624613;
EST2119 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088C011, mRNA sequence.

EL624614; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL624614;
EST2120 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088C041, mRNA sequence.

EL624615; SV 1; linear; mRNA; EST; PLN; 387 BP.
EL624615;
EST2121 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088C071, mRNA sequence.

EL624616; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL624616;
EST2122 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088C081, mRNA sequence.

EL624617; SV 1; linear; mRNA; EST; PLN; 646 BP.
EL624617;
EST2123 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088C101, mRNA sequence.

EL624618; SV 1; linear; mRNA; EST; PLN; 372 BP.
EL624618;
EST2124 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088D021, mRNA sequence.

EL624619; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL624619;
EST2125 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088E051, mRNA sequence.

EL624620; SV 1; linear; mRNA; EST; PLN; 627 BP.
EL624620;
EST2126 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088E061, mRNA sequence.

EL624621; SV 1; linear; mRNA; EST; PLN; 669 BP.
EL624621;
EST2127 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088E081, mRNA sequence.

EL624622; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL624622;
EST2128 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088E121, mRNA sequence.

EL624623; SV 1; linear; mRNA; EST; PLN; 308 BP.
EL624623;
EST2129 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088F011, mRNA sequence.

EL624624; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL624624;
EST2130 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088F041, mRNA sequence.

EL624625; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL624625;
EST2131 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088G021, mRNA sequence.

EL624626; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL624626;
EST2132 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088G071, mRNA sequence.

EL624627; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL624627;
EST2133 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088G091, mRNA sequence.

EL624628; SV 1; linear; mRNA; EST; PLN; 640 BP.
EL624628;
EST2134 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088H011, mRNA sequence.

EL624629; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL624629;
EST2135 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B088H031, mRNA sequence.

EL624630; SV 1; linear; mRNA; EST; PLN; 648 BP.
EL624630;
EST2136 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089A021, mRNA sequence.

EL624631; SV 1; linear; mRNA; EST; PLN; 810 BP.
EL624631;
EST2137 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089A041, mRNA sequence.

EL624632; SV 1; linear; mRNA; EST; PLN; 715 BP.
EL624632;
EST2138 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089A051, mRNA sequence.

EL624633; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL624633;
EST2139 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089B021, mRNA sequence.

EL624634; SV 1; linear; mRNA; EST; PLN; 803 BP.
EL624634;
EST2140 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089C021, mRNA sequence.

EL624635; SV 1; linear; mRNA; EST; PLN; 645 BP.
EL624635;
EST2141 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089C081, mRNA sequence.

EL624636; SV 1; linear; mRNA; EST; PLN; 900 BP.
EL624636;
EST2142 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089D031, mRNA sequence.

EL624637; SV 1; linear; mRNA; EST; PLN; 642 BP.
EL624637;
EST2143 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089D041, mRNA sequence.

EL624638; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL624638;
EST2144 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089D091, mRNA sequence.

EL624639; SV 1; linear; mRNA; EST; PLN; 811 BP.
EL624639;
EST2145 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089E031, mRNA sequence.

EL624640; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL624640;
EST2146 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089E111, mRNA sequence.

EL624641; SV 1; linear; mRNA; EST; PLN; 714 BP.
EL624641;
EST2147 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089F011, mRNA sequence.

EL624642; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL624642;
EST2148 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089F091, mRNA sequence.

EL624643; SV 1; linear; mRNA; EST; PLN; 819 BP.
EL624643;
EST2149 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089F121, mRNA sequence.

EL624644; SV 1; linear; mRNA; EST; PLN; 720 BP.
EL624644;
EST2150 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089G021, mRNA sequence.

EL624645; SV 1; linear; mRNA; EST; PLN; 845 BP.
EL624645;
EST2151 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089G061, mRNA sequence.

EL624646; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL624646;
EST2152 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089G101, mRNA sequence.

EL624647; SV 1; linear; mRNA; EST; PLN; 839 BP.
EL624647;
EST2153 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089G121, mRNA sequence.

EL624648; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL624648;
EST2154 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089H021, mRNA sequence.

EL624649; SV 1; linear; mRNA; EST; PLN; 795 BP.
EL624649;
EST2155 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089H051, mRNA sequence.

EL624650; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL624650;
EST2156 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089H061, mRNA sequence.

EL624651; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL624651;
EST2157 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089H081, mRNA sequence.

EL624652; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL624652;
EST2158 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B089H101, mRNA sequence.

EL624653; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL624653;
EST2159 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090A031, mRNA sequence.

EL624654; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL624654;
EST2160 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090A041, mRNA sequence.

EL624655; SV 1; linear; mRNA; EST; PLN; 625 BP.
EL624655;
EST2161 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090A051, mRNA sequence.

EL624656; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL624656;
EST2162 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090A111, mRNA sequence.

EL624657; SV 1; linear; mRNA; EST; PLN; 670 BP.
EL624657;
EST2163 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090B021, mRNA sequence.

EL624658; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL624658;
EST2164 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090B051, mRNA sequence.

EL624659; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL624659;
EST2165 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090B121, mRNA sequence.

EL624660; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL624660;
EST2166 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090C041, mRNA sequence.

EL624661; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL624661;
EST2167 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090C051, mRNA sequence.

EL624662; SV 1; linear; mRNA; EST; PLN; 372 BP.
EL624662;
EST2168 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090C071, mRNA sequence.

EL624663; SV 1; linear; mRNA; EST; PLN; 663 BP.
EL624663;
EST2169 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090C091, mRNA sequence.

EL624664; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL624664;
EST2170 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090D011, mRNA sequence.

EL624665; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL624665;
EST2171 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090D031, mRNA sequence.

EL624666; SV 1; linear; mRNA; EST; PLN; 602 BP.
EL624666;
EST2172 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090E111, mRNA sequence.

EL624667; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL624667;
EST2173 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090E121, mRNA sequence.

EL624668; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL624668;
EST2174 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090F011, mRNA sequence.

EL624669; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL624669;
EST2175 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090F021, mRNA sequence.

EL624670; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL624670;
EST2176 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090F061, mRNA sequence.

EL624671; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL624671;
EST2177 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090F071, mRNA sequence.

EL624672; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL624672;
EST2178 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090F091, mRNA sequence.

EL624673; SV 1; linear; mRNA; EST; PLN; 575 BP.
EL624673;
EST2179 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090F121, mRNA sequence.

EL624674; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL624674;
EST2180 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090G031, mRNA sequence.

EL624675; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL624675;
EST2181 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090H011, mRNA sequence.

EL624676; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL624676;
EST2182 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090H021, mRNA sequence.

EL624677; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL624677;
EST2183 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090H041, mRNA sequence.

EL624678; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL624678;
EST2184 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B090H051, mRNA sequence.

EL624679; SV 1; linear; mRNA; EST; PLN; 348 BP.
EL624679;
EST2185 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091A071, mRNA sequence.

EL624680; SV 1; linear; mRNA; EST; PLN; 591 BP.
EL624680;
EST2186 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091B021, mRNA sequence.

EL624681; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL624681;
EST2187 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091B061, mRNA sequence.

EL624682; SV 1; linear; mRNA; EST; PLN; 462 BP.
EL624682;
EST2188 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091C111, mRNA sequence.

EL624683; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL624683;
EST2189 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091C121, mRNA sequence.

EL624684; SV 1; linear; mRNA; EST; PLN; 618 BP.
EL624684;
EST2190 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091D011, mRNA sequence.

EL624685; SV 1; linear; mRNA; EST; PLN; 423 BP.
EL624685;
EST2191 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091D041, mRNA sequence.

EL624686; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL624686;
EST2192 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091D081, mRNA sequence.

EL624687; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL624687;
EST2193 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091D091, mRNA sequence.

EL624688; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL624688;
EST2194 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091D111, mRNA sequence.

EL624689; SV 1; linear; mRNA; EST; PLN; 411 BP.
EL624689;
EST2195 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091E031, mRNA sequence.

EL624690; SV 1; linear; mRNA; EST; PLN; 617 BP.
EL624690;
EST2196 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091E051, mRNA sequence.

EL624691; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL624691;
EST2197 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091F021, mRNA sequence.

EL624692; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL624692;
EST2198 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091F071, mRNA sequence.

EL624693; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL624693;
EST2199 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091G071, mRNA sequence.

EL624694; SV 1; linear; mRNA; EST; PLN; 373 BP.
EL624694;
EST2200 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091G111, mRNA sequence.

EL624695; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL624695;
EST2201 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091H011, mRNA sequence.

EL624696; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL624696;
EST2202 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091H031, mRNA sequence.

EL624697; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL624697;
EST2203 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B091H081, mRNA sequence.

EL624698; SV 1; linear; mRNA; EST; PLN; 423 BP.
EL624698;
EST2204 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092A041, mRNA sequence.

EL624699; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL624699;
EST2205 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092A091, mRNA sequence.

EL624700; SV 1; linear; mRNA; EST; PLN; 447 BP.
EL624700;
EST2206 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092A101, mRNA sequence.

EL624701; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL624701;
EST2207 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092A111, mRNA sequence.

EL624702; SV 1; linear; mRNA; EST; PLN; 443 BP.
EL624702;
EST2208 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092A121, mRNA sequence.

EL624703; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL624703;
EST2209 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092B011, mRNA sequence.

EL624704; SV 1; linear; mRNA; EST; PLN; 423 BP.
EL624704;
EST2210 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092B031, mRNA sequence.

EL624705; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL624705;
EST2211 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092B041, mRNA sequence.

EL624706; SV 1; linear; mRNA; EST; PLN; 359 BP.
EL624706;
EST2212 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092B051, mRNA sequence.

EL624707; SV 1; linear; mRNA; EST; PLN; 399 BP.
EL624707;
EST2213 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092B071, mRNA sequence.

EL624708; SV 1; linear; mRNA; EST; PLN; 455 BP.
EL624708;
EST2214 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092B121, mRNA sequence.

EL624709; SV 1; linear; mRNA; EST; PLN; 420 BP.
EL624709;
EST2215 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092C021, mRNA sequence.

EL624710; SV 1; linear; mRNA; EST; PLN; 501 BP.
EL624710;
EST2216 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092D071, mRNA sequence.

EL624711; SV 1; linear; mRNA; EST; PLN; 323 BP.
EL624711;
EST2217 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092D111, mRNA sequence.

EL624712; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL624712;
EST2218 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092D121, mRNA sequence.

EL624713; SV 1; linear; mRNA; EST; PLN; 397 BP.
EL624713;
EST2219 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092E021, mRNA sequence.

EL624714; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL624714;
EST2220 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092E031, mRNA sequence.

EL624715; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL624715;
EST2221 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092F011, mRNA sequence.

EL624716; SV 1; linear; mRNA; EST; PLN; 648 BP.
EL624716;
EST2222 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092G011, mRNA sequence.

EL624717; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL624717;
EST2223 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092G051, mRNA sequence.

EL624718; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL624718;
EST2224 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092G081, mRNA sequence.

EL624719; SV 1; linear; mRNA; EST; PLN; 631 BP.
EL624719;
EST2225 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092G091, mRNA sequence.

EL624720; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL624720;
EST2226 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092G101, mRNA sequence.

EL624721; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL624721;
EST2227 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092G121, mRNA sequence.

EL624722; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL624722;
EST2228 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092H021, mRNA sequence.

EL624723; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL624723;
EST2229 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092H061, mRNA sequence.

EL624724; SV 1; linear; mRNA; EST; PLN; 474 BP.
EL624724;
EST2230 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B092H071, mRNA sequence.

EL624725; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL624725;
EST2231 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093A041, mRNA sequence.

EL624726; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL624726;
EST2232 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093A081, mRNA sequence.

EL624727; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL624727;
EST2233 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093A091, mRNA sequence.

EL624728; SV 1; linear; mRNA; EST; PLN; 406 BP.
EL624728;
EST2234 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093A111, mRNA sequence.

EL624729; SV 1; linear; mRNA; EST; PLN; 530 BP.
EL624729;
EST2235 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093A121, mRNA sequence.

EL624730; SV 1; linear; mRNA; EST; PLN; 407 BP.
EL624730;
EST2236 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093B021, mRNA sequence.

EL624731; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL624731;
EST2237 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093B071, mRNA sequence.

EL624732; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL624732;
EST2238 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093B091, mRNA sequence.

EL624733; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL624733;
EST2239 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093B111, mRNA sequence.

EL624734; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL624734;
EST2240 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093C091, mRNA sequence.

EL624735; SV 1; linear; mRNA; EST; PLN; 709 BP.
EL624735;
EST2241 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093C111, mRNA sequence.

EL624736; SV 1; linear; mRNA; EST; PLN; 815 BP.
EL624736;
EST2242 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093D041, mRNA sequence.

EL624737; SV 1; linear; mRNA; EST; PLN; 745 BP.
EL624737;
EST2243 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093D051, mRNA sequence.

EL624738; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL624738;
EST2244 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093D091, mRNA sequence.

EL624739; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL624739;
EST2245 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093D101, mRNA sequence.

EL624740; SV 1; linear; mRNA; EST; PLN; 636 BP.
EL624740;
EST2246 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093D111, mRNA sequence.

EL624741; SV 1; linear; mRNA; EST; PLN; 780 BP.
EL624741;
EST2247 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093E011, mRNA sequence.

EL624742; SV 1; linear; mRNA; EST; PLN; 840 BP.
EL624742;
EST2248 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093E061, mRNA sequence.

EL624743; SV 1; linear; mRNA; EST; PLN; 841 BP.
EL624743;
EST2249 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093F021, mRNA sequence.

EL624744; SV 1; linear; mRNA; EST; PLN; 836 BP.
EL624744;
EST2250 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093F051, mRNA sequence.

EL624745; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL624745;
EST2251 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093F091, mRNA sequence.

EL624746; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL624746;
EST2252 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093F101, mRNA sequence.

EL624747; SV 1; linear; mRNA; EST; PLN; 606 BP.
EL624747;
EST2253 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093G061, mRNA sequence.

EL624748; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL624748;
EST2254 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093G081, mRNA sequence.

EL624749; SV 1; linear; mRNA; EST; PLN; 844 BP.
EL624749;
EST2255 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093G111, mRNA sequence.

EL624750; SV 1; linear; mRNA; EST; PLN; 851 BP.
EL624750;
EST2256 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093G121, mRNA sequence.

EL624751; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL624751;
EST2257 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093H011, mRNA sequence.

EL624752; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL624752;
EST2258 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093H071, mRNA sequence.

EL624753; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL624753;
EST2259 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093H091, mRNA sequence.

EL624754; SV 1; linear; mRNA; EST; PLN; 829 BP.
EL624754;
EST2260 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B093H101, mRNA sequence.

EL624755; SV 1; linear; mRNA; EST; PLN; 821 BP.
EL624755;
EST2261 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094A021, mRNA sequence.

EL624756; SV 1; linear; mRNA; EST; PLN; 722 BP.
EL624756;
EST2262 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094A031, mRNA sequence.

EL624757; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL624757;
EST2263 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094B011, mRNA sequence.

EL624758; SV 1; linear; mRNA; EST; PLN; 794 BP.
EL624758;
EST2264 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094B031, mRNA sequence.

EL624759; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL624759;
EST2265 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094B061, mRNA sequence.

EL624760; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL624760;
EST2266 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094B071, mRNA sequence.

EL624761; SV 1; linear; mRNA; EST; PLN; 837 BP.
EL624761;
EST2267 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094B111, mRNA sequence.

EL624762; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL624762;
EST2268 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094C031, mRNA sequence.

EL624763; SV 1; linear; mRNA; EST; PLN; 812 BP.
EL624763;
EST2269 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094C051, mRNA sequence.

EL624764; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL624764;
EST2270 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094C091, mRNA sequence.

EL624765; SV 1; linear; mRNA; EST; PLN; 714 BP.
EL624765;
EST2271 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094D091, mRNA sequence.

EL624766; SV 1; linear; mRNA; EST; PLN; 909 BP.
EL624766;
EST2272 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094D111, mRNA sequence.

EL624767; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL624767;
EST2273 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094D121, mRNA sequence.

EL624768; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL624768;
EST2274 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094E031, mRNA sequence.

EL624769; SV 1; linear; mRNA; EST; PLN; 863 BP.
EL624769;
EST2275 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094E051, mRNA sequence.

EL624770; SV 1; linear; mRNA; EST; PLN; 816 BP.
EL624770;
EST2276 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094E081, mRNA sequence.

EL624771; SV 1; linear; mRNA; EST; PLN; 826 BP.
EL624771;
EST2277 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094F101, mRNA sequence.

EL624772; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL624772;
EST2278 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094F121, mRNA sequence.

EL624773; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL624773;
EST2279 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094G071, mRNA sequence.

EL624774; SV 1; linear; mRNA; EST; PLN; 842 BP.
EL624774;
EST2280 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094G081, mRNA sequence.

EL624775; SV 1; linear; mRNA; EST; PLN; 746 BP.
EL624775;
EST2281 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094G111, mRNA sequence.

EL624776; SV 1; linear; mRNA; EST; PLN; 803 BP.
EL624776;
EST2282 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094H021, mRNA sequence.

EL624777; SV 1; linear; mRNA; EST; PLN; 839 BP.
EL624777;
EST2283 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094H031, mRNA sequence.

EL624778; SV 1; linear; mRNA; EST; PLN; 902 BP.
EL624778;
EST2284 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094H071, mRNA sequence.

EL624779; SV 1; linear; mRNA; EST; PLN; 849 BP.
EL624779;
EST2285 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B094H111, mRNA sequence.

EL624780; SV 1; linear; mRNA; EST; PLN; 600 BP.
EL624780;
EST2286 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095A011, mRNA sequence.

EL624781; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL624781;
EST2287 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095A061, mRNA sequence.

EL624782; SV 1; linear; mRNA; EST; PLN; 501 BP.
EL624782;
EST2288 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095A081, mRNA sequence.

EL624783; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL624783;
EST2289 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095B021, mRNA sequence.

EL624784; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL624784;
EST2290 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095B051, mRNA sequence.

EL624785; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL624785;
EST2291 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095B101, mRNA sequence.

EL624786; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL624786;
EST2292 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095C081, mRNA sequence.

EL624787; SV 1; linear; mRNA; EST; PLN; 616 BP.
EL624787;
EST2293 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095C091, mRNA sequence.

EL624788; SV 1; linear; mRNA; EST; PLN; 507 BP.
EL624788;
EST2294 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095D081, mRNA sequence.

EL624789; SV 1; linear; mRNA; EST; PLN; 476 BP.
EL624789;
EST2295 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095D111, mRNA sequence.

EL624790; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL624790;
EST2296 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095E021, mRNA sequence.

EL624791; SV 1; linear; mRNA; EST; PLN; 447 BP.
EL624791;
EST2297 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095E041, mRNA sequence.

EL624792; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL624792;
EST2298 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095E051, mRNA sequence.

EL624793; SV 1; linear; mRNA; EST; PLN; 589 BP.
EL624793;
EST2299 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095E071, mRNA sequence.

EL624794; SV 1; linear; mRNA; EST; PLN; 406 BP.
EL624794;
EST2300 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095E081, mRNA sequence.

EL624795; SV 1; linear; mRNA; EST; PLN; 472 BP.
EL624795;
EST2301 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095F101, mRNA sequence.

EL624796; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL624796;
EST2302 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095G091, mRNA sequence.

EL624797; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL624797;
EST2303 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095G111, mRNA sequence.

EL624798; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL624798;
EST2304 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095G121, mRNA sequence.

EL624799; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL624799;
EST2305 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095H021, mRNA sequence.

EL624800; SV 1; linear; mRNA; EST; PLN; 606 BP.
EL624800;
EST2306 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095H041, mRNA sequence.

EL624801; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL624801;
EST2307 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095H061, mRNA sequence.

EL624802; SV 1; linear; mRNA; EST; PLN; 724 BP.
EL624802;
EST2308 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B095H121, mRNA sequence.

EL624803; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL624803;
EST2309 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096A031, mRNA sequence.

EL624804; SV 1; linear; mRNA; EST; PLN; 736 BP.
EL624804;
EST2310 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096A051, mRNA sequence.

EL624805; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL624805;
EST2311 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096A061, mRNA sequence.

EL624806; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL624806;
EST2312 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096A091, mRNA sequence.

EL624807; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL624807;
EST2313 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096B031, mRNA sequence.

EL624808; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL624808;
EST2314 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096B041, mRNA sequence.

EL624809; SV 1; linear; mRNA; EST; PLN; 811 BP.
EL624809;
EST2315 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096B091, mRNA sequence.

EL624810; SV 1; linear; mRNA; EST; PLN; 793 BP.
EL624810;
EST2316 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096B111, mRNA sequence.

EL624811; SV 1; linear; mRNA; EST; PLN; 817 BP.
EL624811;
EST2317 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096C071, mRNA sequence.

EL624812; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL624812;
EST2318 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096C101, mRNA sequence.

EL624813; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL624813;
EST2319 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096C111, mRNA sequence.

EL624814; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL624814;
EST2320 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096D031, mRNA sequence.

EL624815; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL624815;
EST2321 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096D051, mRNA sequence.

EL624816; SV 1; linear; mRNA; EST; PLN; 615 BP.
EL624816;
EST2322 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096D071, mRNA sequence.

EL624817; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL624817;
EST2323 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096D081, mRNA sequence.

EL624818; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL624818;
EST2324 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096D101, mRNA sequence.

EL624819; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL624819;
EST2325 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096E051, mRNA sequence.

EL624820; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL624820;
EST2326 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096E061, mRNA sequence.

EL624821; SV 1; linear; mRNA; EST; PLN; 770 BP.
EL624821;
EST2327 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096F031, mRNA sequence.

EL624822; SV 1; linear; mRNA; EST; PLN; 603 BP.
EL624822;
EST2328 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096F101, mRNA sequence.

EL624823; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL624823;
EST2329 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096F121, mRNA sequence.

EL624824; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL624824;
EST2330 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096G011, mRNA sequence.

EL624825; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL624825;
EST2331 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096G031, mRNA sequence.

EL624826; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL624826;
EST2332 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096G051, mRNA sequence.

EL624827; SV 1; linear; mRNA; EST; PLN; 750 BP.
EL624827;
EST2333 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096G061, mRNA sequence.

EL624828; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL624828;
EST2334 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096H101, mRNA sequence.

EL624829; SV 1; linear; mRNA; EST; PLN; 646 BP.
EL624829;
EST2335 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B096H111, mRNA sequence.

EL624830; SV 1; linear; mRNA; EST; PLN; 643 BP.
EL624830;
EST2336 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097A011, mRNA sequence.

EL624831; SV 1; linear; mRNA; EST; PLN; 451 BP.
EL624831;
EST2337 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097A031, mRNA sequence.

EL624832; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL624832;
EST2338 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097B031, mRNA sequence.

EL624833; SV 1; linear; mRNA; EST; PLN; 673 BP.
EL624833;
EST2339 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097B071, mRNA sequence.

EL624834; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL624834;
EST2340 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097B091, mRNA sequence.

EL624835; SV 1; linear; mRNA; EST; PLN; 628 BP.
EL624835;
EST2341 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097B101, mRNA sequence.

EL624836; SV 1; linear; mRNA; EST; PLN; 719 BP.
EL624836;
EST2342 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097C011, mRNA sequence.

EL624837; SV 1; linear; mRNA; EST; PLN; 600 BP.
EL624837;
EST2343 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097C051, mRNA sequence.

EL624838; SV 1; linear; mRNA; EST; PLN; 653 BP.
EL624838;
EST2344 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097C081, mRNA sequence.

EL624839; SV 1; linear; mRNA; EST; PLN; 803 BP.
EL624839;
EST2345 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097C111, mRNA sequence.

EL624840; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL624840;
EST2346 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097D011, mRNA sequence.

EL624841; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL624841;
EST2347 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097D021, mRNA sequence.

EL624842; SV 1; linear; mRNA; EST; PLN; 606 BP.
EL624842;
EST2348 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097E071, mRNA sequence.

EL624843; SV 1; linear; mRNA; EST; PLN; 770 BP.
EL624843;
EST2349 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097F081, mRNA sequence.

EL624844; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL624844;
EST2350 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097F101, mRNA sequence.

EL624845; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL624845;
EST2351 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097G091, mRNA sequence.

EL624846; SV 1; linear; mRNA; EST; PLN; 368 BP.
EL624846;
EST2352 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B097H051, mRNA sequence.

EL624847; SV 1; linear; mRNA; EST; PLN; 416 BP.
EL624847;
EST2353 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098A021, mRNA sequence.

EL624848; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL624848;
EST2354 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098A031, mRNA sequence.

EL624849; SV 1; linear; mRNA; EST; PLN; 385 BP.
EL624849;
EST2355 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098A061, mRNA sequence.

EL624850; SV 1; linear; mRNA; EST; PLN; 494 BP.
EL624850;
EST2356 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098B011, mRNA sequence.

EL624851; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL624851;
EST2357 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098B021, mRNA sequence.

EL624852; SV 1; linear; mRNA; EST; PLN; 647 BP.
EL624852;
EST2358 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098B061, mRNA sequence.

EL624853; SV 1; linear; mRNA; EST; PLN; 473 BP.
EL624853;
EST2359 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098B071, mRNA sequence.

EL624854; SV 1; linear; mRNA; EST; PLN; 389 BP.
EL624854;
EST2360 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098B081, mRNA sequence.

EL624855; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL624855;
EST2361 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098C011, mRNA sequence.

EL624856; SV 1; linear; mRNA; EST; PLN; 455 BP.
EL624856;
EST2362 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098C071, mRNA sequence.

EL624857; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL624857;
EST2363 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098C121, mRNA sequence.

EL624858; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL624858;
EST2364 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098D011, mRNA sequence.

EL624859; SV 1; linear; mRNA; EST; PLN; 363 BP.
EL624859;
EST2365 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098D031, mRNA sequence.

EL624860; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL624860;
EST2366 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098D051, mRNA sequence.

EL624861; SV 1; linear; mRNA; EST; PLN; 530 BP.
EL624861;
EST2367 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098D061, mRNA sequence.

EL624862; SV 1; linear; mRNA; EST; PLN; 361 BP.
EL624862;
EST2368 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098D111, mRNA sequence.

EL624863; SV 1; linear; mRNA; EST; PLN; 289 BP.
EL624863;
EST2369 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098E011, mRNA sequence.

EL624864; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL624864;
EST2370 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098E121, mRNA sequence.

EL624865; SV 1; linear; mRNA; EST; PLN; 355 BP.
EL624865;
EST2371 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098F041, mRNA sequence.

EL624866; SV 1; linear; mRNA; EST; PLN; 260 BP.
EL624866;
EST2372 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098F061, mRNA sequence.

EL624867; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL624867;
EST2373 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098F071, mRNA sequence.

EL624868; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL624868;
EST2374 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B098H031, mRNA sequence.

EL624869; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL624869;
EST2375 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099A021, mRNA sequence.

EL624870; SV 1; linear; mRNA; EST; PLN; 426 BP.
EL624870;
EST2376 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099B041, mRNA sequence.

EL624871; SV 1; linear; mRNA; EST; PLN; 615 BP.
EL624871;
EST2377 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099C021, mRNA sequence.

EL624872; SV 1; linear; mRNA; EST; PLN; 622 BP.
EL624872;
EST2378 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099C031, mRNA sequence.

EL624873; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL624873;
EST2379 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099C061, mRNA sequence.

EL624874; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL624874;
EST2380 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099C071, mRNA sequence.

EL624875; SV 1; linear; mRNA; EST; PLN; 612 BP.
EL624875;
EST2381 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099C081, mRNA sequence.

EL624876; SV 1; linear; mRNA; EST; PLN; 299 BP.
EL624876;
EST2382 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099D041, mRNA sequence.

EL624877; SV 1; linear; mRNA; EST; PLN; 534 BP.
EL624877;
EST2383 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099D061, mRNA sequence.

EL624878; SV 1; linear; mRNA; EST; PLN; 382 BP.
EL624878;
EST2384 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099D071, mRNA sequence.

EL624879; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL624879;
EST2385 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099D101, mRNA sequence.

EL624880; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL624880;
EST2386 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099D111, mRNA sequence.

EL624881; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL624881;
EST2387 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099E071, mRNA sequence.

EL624882; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL624882;
EST2388 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099E091, mRNA sequence.

EL624883; SV 1; linear; mRNA; EST; PLN; 568 BP.
EL624883;
EST2389 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099E111, mRNA sequence.

EL624884; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL624884;
EST2390 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099F081, mRNA sequence.

EL624885; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL624885;
EST2391 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099F101, mRNA sequence.

EL624886; SV 1; linear; mRNA; EST; PLN; 472 BP.
EL624886;
EST2392 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B099H091, mRNA sequence.

EL624887; SV 1; linear; mRNA; EST; PLN; 413 BP.
EL624887;
EST2393 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100A011, mRNA sequence.

EL624888; SV 1; linear; mRNA; EST; PLN; 359 BP.
EL624888;
EST2394 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100A021, mRNA sequence.

EL624889; SV 1; linear; mRNA; EST; PLN; 274 BP.
EL624889;
EST2395 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100A041, mRNA sequence.

EL624890; SV 1; linear; mRNA; EST; PLN; 416 BP.
EL624890;
EST2396 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100A071, mRNA sequence.

EL624891; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL624891;
EST2397 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100A091, mRNA sequence.

EL624892; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL624892;
EST2398 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100A101, mRNA sequence.

EL624893; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL624893;
EST2399 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100B021, mRNA sequence.

EL624894; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL624894;
EST2400 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100B031, mRNA sequence.

EL624895; SV 1; linear; mRNA; EST; PLN; 550 BP.
EL624895;
EST2401 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100B041, mRNA sequence.

EL624896; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL624896;
EST2402 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100B091, mRNA sequence.

EL624897; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL624897;
EST2403 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100C011, mRNA sequence.

EL624898; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL624898;
EST2404 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100C031, mRNA sequence.

EL624899; SV 1; linear; mRNA; EST; PLN; 590 BP.
EL624899;
EST2405 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100C041, mRNA sequence.

EL624900; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL624900;
EST2406 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100C051, mRNA sequence.

EL624901; SV 1; linear; mRNA; EST; PLN; 500 BP.
EL624901;
EST2407 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100C081, mRNA sequence.

EL624902; SV 1; linear; mRNA; EST; PLN; 595 BP.
EL624902;
EST2408 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100C091, mRNA sequence.

EL624903; SV 1; linear; mRNA; EST; PLN; 490 BP.
EL624903;
EST2409 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100C121, mRNA sequence.

EL624904; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL624904;
EST2410 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100D021, mRNA sequence.

EL624905; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL624905;
EST2411 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100D031, mRNA sequence.

EL624906; SV 1; linear; mRNA; EST; PLN; 550 BP.
EL624906;
EST2412 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100E021, mRNA sequence.

EL624907; SV 1; linear; mRNA; EST; PLN; 437 BP.
EL624907;
EST2413 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100E071, mRNA sequence.

EL624908; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL624908;
EST2414 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100E101, mRNA sequence.

EL624909; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL624909;
EST2415 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100F031, mRNA sequence.

EL624910; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL624910;
EST2416 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100G051, mRNA sequence.

EL624911; SV 1; linear; mRNA; EST; PLN; 621 BP.
EL624911;
EST2417 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100G071, mRNA sequence.

EL624912; SV 1; linear; mRNA; EST; PLN; 659 BP.
EL624912;
EST2418 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100G121, mRNA sequence.

EL624913; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL624913;
EST2419 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100H011, mRNA sequence.

EL624914; SV 1; linear; mRNA; EST; PLN; 342 BP.
EL624914;
EST2420 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B100H051, mRNA sequence.

EL624915; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL624915;
EST2421 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101A041, mRNA sequence.

EL624916; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL624916;
EST2422 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101B011, mRNA sequence.

EL624917; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL624917;
EST2423 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101B091, mRNA sequence.

EL624918; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL624918;
EST2424 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101B111, mRNA sequence.

EL624919; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL624919;
EST2425 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101C051, mRNA sequence.

EL624920; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL624920;
EST2426 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101D011, mRNA sequence.

EL624921; SV 1; linear; mRNA; EST; PLN; 317 BP.
EL624921;
EST2427 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101D021, mRNA sequence.

EL624922; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL624922;
EST2428 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101D031, mRNA sequence.

EL624923; SV 1; linear; mRNA; EST; PLN; 403 BP.
EL624923;
EST2429 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101D051, mRNA sequence.

EL624924; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL624924;
EST2430 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101D061, mRNA sequence.

EL624925; SV 1; linear; mRNA; EST; PLN; 587 BP.
EL624925;
EST2431 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101D111, mRNA sequence.

EL624926; SV 1; linear; mRNA; EST; PLN; 650 BP.
EL624926;
EST2432 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101E081, mRNA sequence.

EL624927; SV 1; linear; mRNA; EST; PLN; 346 BP.
EL624927;
EST2433 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101E121, mRNA sequence.

EL624928; SV 1; linear; mRNA; EST; PLN; 422 BP.
EL624928;
EST2434 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101F011, mRNA sequence.

EL624929; SV 1; linear; mRNA; EST; PLN; 324 BP.
EL624929;
EST2435 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101F021, mRNA sequence.

EL624930; SV 1; linear; mRNA; EST; PLN; 481 BP.
EL624930;
EST2436 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101F031, mRNA sequence.

EL624931; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL624931;
EST2437 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101G021, mRNA sequence.

EL624932; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL624932;
EST2438 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101G101, mRNA sequence.

EL624933; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL624933;
EST2439 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101H021, mRNA sequence.

EL624934; SV 1; linear; mRNA; EST; PLN; 399 BP.
EL624934;
EST2440 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101H041, mRNA sequence.

EL624935; SV 1; linear; mRNA; EST; PLN; 421 BP.
EL624935;
EST2441 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B101H101, mRNA sequence.

EL624936; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL624936;
EST2442 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102A021, mRNA sequence.

EL624937; SV 1; linear; mRNA; EST; PLN; 391 BP.
EL624937;
EST2443 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102A041, mRNA sequence.

EL624938; SV 1; linear; mRNA; EST; PLN; 753 BP.
EL624938;
EST2444 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102A051, mRNA sequence.

EL624939; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL624939;
EST2445 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102A091, mRNA sequence.

EL624940; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL624940;
EST2446 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102A121, mRNA sequence.

EL624941; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL624941;
EST2447 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102B021, mRNA sequence.

EL624942; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL624942;
EST2448 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102B031, mRNA sequence.

EL624943; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL624943;
EST2449 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102B061, mRNA sequence.

EL624944; SV 1; linear; mRNA; EST; PLN; 414 BP.
EL624944;
EST2450 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102B091, mRNA sequence.

EL624945; SV 1; linear; mRNA; EST; PLN; 437 BP.
EL624945;
EST2451 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102C031, mRNA sequence.

EL624946; SV 1; linear; mRNA; EST; PLN; 311 BP.
EL624946;
EST2452 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102C051, mRNA sequence.

EL624947; SV 1; linear; mRNA; EST; PLN; 393 BP.
EL624947;
EST2453 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102C111, mRNA sequence.

EL624948; SV 1; linear; mRNA; EST; PLN; 460 BP.
EL624948;
EST2454 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102D041, mRNA sequence.

EL624949; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL624949;
EST2455 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102D051, mRNA sequence.

EL624950; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL624950;
EST2456 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102E011, mRNA sequence.

EL624951; SV 1; linear; mRNA; EST; PLN; 429 BP.
EL624951;
EST2457 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102E031, mRNA sequence.

EL624952; SV 1; linear; mRNA; EST; PLN; 491 BP.
EL624952;
EST2458 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102E081, mRNA sequence.

EL624953; SV 1; linear; mRNA; EST; PLN; 420 BP.
EL624953;
EST2459 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102E121, mRNA sequence.

EL624954; SV 1; linear; mRNA; EST; PLN; 276 BP.
EL624954;
EST2460 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102F071, mRNA sequence.

EL624955; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL624955;
EST2461 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102F101, mRNA sequence.

EL624956; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL624956;
EST2462 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102G021, mRNA sequence.

EL624957; SV 1; linear; mRNA; EST; PLN; 504 BP.
EL624957;
EST2463 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102G091, mRNA sequence.

EL624958; SV 1; linear; mRNA; EST; PLN; 829 BP.
EL624958;
EST2464 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102H051, mRNA sequence.

EL624959; SV 1; linear; mRNA; EST; PLN; 752 BP.
EL624959;
EST2465 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102H061, mRNA sequence.

EL624960; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL624960;
EST2466 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B102H111, mRNA sequence.

EL624961; SV 1; linear; mRNA; EST; PLN; 771 BP.
EL624961;
EST2467 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103A091, mRNA sequence.

EL624962; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL624962;
EST2468 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103B011, mRNA sequence.

EL624963; SV 1; linear; mRNA; EST; PLN; 460 BP.
EL624963;
EST2469 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103B021, mRNA sequence.

EL624964; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL624964;
EST2470 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103B031, mRNA sequence.

EL624965; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL624965;
EST2471 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103B071, mRNA sequence.

EL624966; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL624966;
EST2472 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103B091, mRNA sequence.

EL624967; SV 1; linear; mRNA; EST; PLN; 638 BP.
EL624967;
EST2473 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103B101, mRNA sequence.

EL624968; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL624968;
EST2474 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103C031, mRNA sequence.

EL624969; SV 1; linear; mRNA; EST; PLN; 730 BP.
EL624969;
EST2475 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103C061, mRNA sequence.

EL624970; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL624970;
EST2476 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103D011, mRNA sequence.

EL624971; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL624971;
EST2477 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103D081, mRNA sequence.

EL624972; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL624972;
EST2478 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103D101, mRNA sequence.

EL624973; SV 1; linear; mRNA; EST; PLN; 740 BP.
EL624973;
EST2479 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103D111, mRNA sequence.

EL624974; SV 1; linear; mRNA; EST; PLN; 612 BP.
EL624974;
EST2480 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103E021, mRNA sequence.

EL624975; SV 1; linear; mRNA; EST; PLN; 671 BP.
EL624975;
EST2481 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103E041, mRNA sequence.

EL624976; SV 1; linear; mRNA; EST; PLN; 712 BP.
EL624976;
EST2482 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103E091, mRNA sequence.

EL624977; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL624977;
EST2483 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103E121, mRNA sequence.

EL624978; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL624978;
EST2484 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103F021, mRNA sequence.

EL624979; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL624979;
EST2485 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103F031, mRNA sequence.

EL624980; SV 1; linear; mRNA; EST; PLN; 620 BP.
EL624980;
EST2486 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103G011, mRNA sequence.

EL624981; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL624981;
EST2487 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103G051, mRNA sequence.

EL624982; SV 1; linear; mRNA; EST; PLN; 627 BP.
EL624982;
EST2488 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103G091, mRNA sequence.

EL624983; SV 1; linear; mRNA; EST; PLN; 820 BP.
EL624983;
EST2489 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103G121, mRNA sequence.

EL624984; SV 1; linear; mRNA; EST; PLN; 859 BP.
EL624984;
EST2490 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B103H121, mRNA sequence.

EL624985; SV 1; linear; mRNA; EST; PLN; 846 BP.
EL624985;
EST2491 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104A011, mRNA sequence.

EL624986; SV 1; linear; mRNA; EST; PLN; 726 BP.
EL624986;
EST2492 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104A071, mRNA sequence.

EL624987; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL624987;
EST2493 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104A111, mRNA sequence.

EL624988; SV 1; linear; mRNA; EST; PLN; 821 BP.
EL624988;
EST2494 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104A121, mRNA sequence.

EL624989; SV 1; linear; mRNA; EST; PLN; 844 BP.
EL624989;
EST2495 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104B011, mRNA sequence.

EL624990; SV 1; linear; mRNA; EST; PLN; 895 BP.
EL624990;
EST2496 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104B061, mRNA sequence.

EL624991; SV 1; linear; mRNA; EST; PLN; 865 BP.
EL624991;
EST2497 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104B121, mRNA sequence.

EL624992; SV 1; linear; mRNA; EST; PLN; 886 BP.
EL624992;
EST2498 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104C021, mRNA sequence.

EL624993; SV 1; linear; mRNA; EST; PLN; 792 BP.
EL624993;
EST2499 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104D021, mRNA sequence.

EL624994; SV 1; linear; mRNA; EST; PLN; 862 BP.
EL624994;
EST2500 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104D031, mRNA sequence.

EL624995; SV 1; linear; mRNA; EST; PLN; 773 BP.
EL624995;
EST2501 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104D051, mRNA sequence.

EL624996; SV 1; linear; mRNA; EST; PLN; 847 BP.
EL624996;
EST2502 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104D061, mRNA sequence.

EL624997; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL624997;
EST2503 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104D071, mRNA sequence.

EL624998; SV 1; linear; mRNA; EST; PLN; 842 BP.
EL624998;
EST2504 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104D091, mRNA sequence.

EL624999; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL624999;
EST2505 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104D111, mRNA sequence.

EL625000; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL625000;
EST2506 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104E081, mRNA sequence.

EL625001; SV 1; linear; mRNA; EST; PLN; 406 BP.
EL625001;
EST2507 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104E101, mRNA sequence.

EL625002; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL625002;
EST2508 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104F011, mRNA sequence.

EL625003; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL625003;
EST2509 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104F111, mRNA sequence.

EL625004; SV 1; linear; mRNA; EST; PLN; 289 BP.
EL625004;
EST2510 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104G031, mRNA sequence.

EL625005; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL625005;
EST2511 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104G041, mRNA sequence.

EL625006; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL625006;
EST2512 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104G051, mRNA sequence.

EL625007; SV 1; linear; mRNA; EST; PLN; 463 BP.
EL625007;
EST2513 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104G071, mRNA sequence.

EL625008; SV 1; linear; mRNA; EST; PLN; 387 BP.
EL625008;
EST2514 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104H071, mRNA sequence.

EL625009; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL625009;
EST2515 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B104H121, mRNA sequence.

EL625010; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL625010;
EST2516 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105A021, mRNA sequence.

EL625011; SV 1; linear; mRNA; EST; PLN; 356 BP.
EL625011;
EST2517 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105B061, mRNA sequence.

EL625012; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL625012;
EST2518 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105B071, mRNA sequence.

EL625013; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL625013;
EST2519 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105C031, mRNA sequence.

EL625014; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL625014;
EST2520 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105C041, mRNA sequence.

EL625015; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL625015;
EST2521 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105D031, mRNA sequence.

EL625016; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL625016;
EST2522 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105D051, mRNA sequence.

EL625017; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL625017;
EST2523 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105D071, mRNA sequence.

EL625018; SV 1; linear; mRNA; EST; PLN; 778 BP.
EL625018;
EST2524 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105D101, mRNA sequence.

EL625019; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL625019;
EST2525 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105D121, mRNA sequence.

EL625020; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL625020;
EST2526 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105E031, mRNA sequence.

EL625021; SV 1; linear; mRNA; EST; PLN; 730 BP.
EL625021;
EST2527 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105E081, mRNA sequence.

EL625022; SV 1; linear; mRNA; EST; PLN; 724 BP.
EL625022;
EST2528 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105E091, mRNA sequence.

EL625023; SV 1; linear; mRNA; EST; PLN; 810 BP.
EL625023;
EST2529 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105E111, mRNA sequence.

EL625024; SV 1; linear; mRNA; EST; PLN; 785 BP.
EL625024;
EST2530 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105E121, mRNA sequence.

EL625025; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL625025;
EST2531 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105F041, mRNA sequence.

EL625026; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL625026;
EST2532 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105F081, mRNA sequence.

EL625027; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL625027;
EST2533 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105F111, mRNA sequence.

EL625028; SV 1; linear; mRNA; EST; PLN; 751 BP.
EL625028;
EST2534 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105G011, mRNA sequence.

EL625029; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL625029;
EST2535 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105G021, mRNA sequence.

EL625030; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL625030;
EST2536 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105G051, mRNA sequence.

EL625031; SV 1; linear; mRNA; EST; PLN; 840 BP.
EL625031;
EST2537 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105G071, mRNA sequence.

EL625032; SV 1; linear; mRNA; EST; PLN; 408 BP.
EL625032;
EST2538 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105G101, mRNA sequence.

EL625033; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL625033;
EST2539 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105G111, mRNA sequence.

EL625034; SV 1; linear; mRNA; EST; PLN; 591 BP.
EL625034;
EST2540 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105G121, mRNA sequence.

EL625035; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL625035;
EST2541 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B105H111, mRNA sequence.

EL625036; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL625036;
EST2542 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106A031, mRNA sequence.

EL625037; SV 1; linear; mRNA; EST; PLN; 719 BP.
EL625037;
EST2543 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106A071, mRNA sequence.

EL625038; SV 1; linear; mRNA; EST; PLN; 726 BP.
EL625038;
EST2544 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106B021, mRNA sequence.

EL625039; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL625039;
EST2545 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106B031, mRNA sequence.

EL625040; SV 1; linear; mRNA; EST; PLN; 831 BP.
EL625040;
EST2546 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106B081, mRNA sequence.

EL625041; SV 1; linear; mRNA; EST; PLN; 674 BP.
EL625041;
EST2547 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106C071, mRNA sequence.

EL625042; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL625042;
EST2548 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106C091, mRNA sequence.

EL625043; SV 1; linear; mRNA; EST; PLN; 856 BP.
EL625043;
EST2549 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106C111, mRNA sequence.

EL625044; SV 1; linear; mRNA; EST; PLN; 746 BP.
EL625044;
EST2550 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106D011, mRNA sequence.

EL625045; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL625045;
EST2551 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106D031, mRNA sequence.

EL625046; SV 1; linear; mRNA; EST; PLN; 618 BP.
EL625046;
EST2552 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106D051, mRNA sequence.

EL625047; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL625047;
EST2553 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106D121, mRNA sequence.

EL625048; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL625048;
EST2554 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106E011, mRNA sequence.

EL625049; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL625049;
EST2555 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106E061, mRNA sequence.

EL625050; SV 1; linear; mRNA; EST; PLN; 507 BP.
EL625050;
EST2556 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106E081, mRNA sequence.

EL625051; SV 1; linear; mRNA; EST; PLN; 484 BP.
EL625051;
EST2557 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106E121, mRNA sequence.

EL625052; SV 1; linear; mRNA; EST; PLN; 851 BP.
EL625052;
EST2558 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106F011, mRNA sequence.

EL625053; SV 1; linear; mRNA; EST; PLN; 664 BP.
EL625053;
EST2559 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106F041, mRNA sequence.

EL625054; SV 1; linear; mRNA; EST; PLN; 860 BP.
EL625054;
EST2560 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106G051, mRNA sequence.

EL625055; SV 1; linear; mRNA; EST; PLN; 833 BP.
EL625055;
EST2561 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106G091, mRNA sequence.

EL625056; SV 1; linear; mRNA; EST; PLN; 415 BP.
EL625056;
EST2562 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106H051, mRNA sequence.

EL625057; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL625057;
EST2563 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B106H121, mRNA sequence.

EL625058; SV 1; linear; mRNA; EST; PLN; 500 BP.
EL625058;
EST2564 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107A011, mRNA sequence.

EL625059; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL625059;
EST2565 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107A051, mRNA sequence.

EL625060; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL625060;
EST2566 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107A061, mRNA sequence.

EL625061; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL625061;
EST2567 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107A071, mRNA sequence.

EL625062; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL625062;
EST2568 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107B011, mRNA sequence.

EL625063; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL625063;
EST2569 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107B021, mRNA sequence.

EL625064; SV 1; linear; mRNA; EST; PLN; 449 BP.
EL625064;
EST2570 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107B071, mRNA sequence.

EL625065; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL625065;
EST2571 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107B121, mRNA sequence.

EL625066; SV 1; linear; mRNA; EST; PLN; 488 BP.
EL625066;
EST2572 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107C041, mRNA sequence.

EL625067; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL625067;
EST2573 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107C051, mRNA sequence.

EL625068; SV 1; linear; mRNA; EST; PLN; 426 BP.
EL625068;
EST2574 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107C061, mRNA sequence.

EL625069; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL625069;
EST2575 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107D071, mRNA sequence.

EL625070; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL625070;
EST2576 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107D091, mRNA sequence.

EL625071; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL625071;
EST2577 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107E011, mRNA sequence.

EL625072; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL625072;
EST2578 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107E041, mRNA sequence.

EL625073; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL625073;
EST2579 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107E091, mRNA sequence.

EL625074; SV 1; linear; mRNA; EST; PLN; 777 BP.
EL625074;
EST2580 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107E111, mRNA sequence.

EL625075; SV 1; linear; mRNA; EST; PLN; 730 BP.
EL625075;
EST2581 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107E121, mRNA sequence.

EL625076; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL625076;
EST2582 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107F021, mRNA sequence.

EL625077; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL625077;
EST2583 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107F061, mRNA sequence.

EL625078; SV 1; linear; mRNA; EST; PLN; 722 BP.
EL625078;
EST2584 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107F101, mRNA sequence.

EL625079; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL625079;
EST2585 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107G071, mRNA sequence.

EL625080; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL625080;
EST2586 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107G101, mRNA sequence.

EL625081; SV 1; linear; mRNA; EST; PLN; 840 BP.
EL625081;
EST2587 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107H011, mRNA sequence.

EL625082; SV 1; linear; mRNA; EST; PLN; 823 BP.
EL625082;
EST2588 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B107H071, mRNA sequence.

EL625083; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625083;
EST2589 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108A011, mRNA sequence.

EL625084; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL625084;
EST2590 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108A111, mRNA sequence.

EL625085; SV 1; linear; mRNA; EST; PLN; 750 BP.
EL625085;
EST2591 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108B041, mRNA sequence.

EL625086; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL625086;
EST2592 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108B081, mRNA sequence.

EL625087; SV 1; linear; mRNA; EST; PLN; 897 BP.
EL625087;
EST2593 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108B091, mRNA sequence.

EL625088; SV 1; linear; mRNA; EST; PLN; 801 BP.
EL625088;
EST2594 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108C031, mRNA sequence.

EL625089; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625089;
EST2595 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108C081, mRNA sequence.

EL625090; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL625090;
EST2596 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108C091, mRNA sequence.

EL625091; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL625091;
EST2597 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108C101, mRNA sequence.

EL625092; SV 1; linear; mRNA; EST; PLN; 844 BP.
EL625092;
EST2598 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108D071, mRNA sequence.

EL625093; SV 1; linear; mRNA; EST; PLN; 721 BP.
EL625093;
EST2599 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108D081, mRNA sequence.

EL625094; SV 1; linear; mRNA; EST; PLN; 631 BP.
EL625094;
EST2600 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108D091, mRNA sequence.

EL625095; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL625095;
EST2601 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108E091, mRNA sequence.

EL625096; SV 1; linear; mRNA; EST; PLN; 725 BP.
EL625096;
EST2602 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108E111, mRNA sequence.

EL625097; SV 1; linear; mRNA; EST; PLN; 687 BP.
EL625097;
EST2603 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108E121, mRNA sequence.

EL625098; SV 1; linear; mRNA; EST; PLN; 674 BP.
EL625098;
EST2604 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108F011, mRNA sequence.

EL625099; SV 1; linear; mRNA; EST; PLN; 836 BP.
EL625099;
EST2605 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108G061, mRNA sequence.

EL625100; SV 1; linear; mRNA; EST; PLN; 853 BP.
EL625100;
EST2606 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108G111, mRNA sequence.

EL625101; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL625101;
EST2607 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108H011, mRNA sequence.

EL625102; SV 1; linear; mRNA; EST; PLN; 865 BP.
EL625102;
EST2608 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108H021, mRNA sequence.

EL625103; SV 1; linear; mRNA; EST; PLN; 810 BP.
EL625103;
EST2609 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108H041, mRNA sequence.

EL625104; SV 1; linear; mRNA; EST; PLN; 874 BP.
EL625104;
EST2610 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B108H111, mRNA sequence.

EL625105; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL625105;
EST2611 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109A011, mRNA sequence.

EL625106; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL625106;
EST2612 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109A021, mRNA sequence.

EL625107; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL625107;
EST2613 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109A041, mRNA sequence.

EL625108; SV 1; linear; mRNA; EST; PLN; 911 BP.
EL625108;
EST2614 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109A061, mRNA sequence.

EL625109; SV 1; linear; mRNA; EST; PLN; 884 BP.
EL625109;
EST2615 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109A111, mRNA sequence.

EL625110; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL625110;
EST2616 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109B011, mRNA sequence.

EL625111; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL625111;
EST2617 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109B121, mRNA sequence.

EL625112; SV 1; linear; mRNA; EST; PLN; 821 BP.
EL625112;
EST2618 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109C041, mRNA sequence.

EL625113; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL625113;
EST2619 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109C051, mRNA sequence.

EL625114; SV 1; linear; mRNA; EST; PLN; 818 BP.
EL625114;
EST2620 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109D061, mRNA sequence.

EL625115; SV 1; linear; mRNA; EST; PLN; 823 BP.
EL625115;
EST2621 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109E011, mRNA sequence.

EL625116; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL625116;
EST2622 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109E071, mRNA sequence.

EL625117; SV 1; linear; mRNA; EST; PLN; 340 BP.
EL625117;
EST2623 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109E081, mRNA sequence.

EL625118; SV 1; linear; mRNA; EST; PLN; 849 BP.
EL625118;
EST2624 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109E101, mRNA sequence.

EL625119; SV 1; linear; mRNA; EST; PLN; 671 BP.
EL625119;
EST2625 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109E111, mRNA sequence.

EL625120; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL625120;
EST2626 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109F061, mRNA sequence.

EL625121; SV 1; linear; mRNA; EST; PLN; 403 BP.
EL625121;
EST2627 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109F081, mRNA sequence.

EL625122; SV 1; linear; mRNA; EST; PLN; 494 BP.
EL625122;
EST2628 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109F091, mRNA sequence.

EL625123; SV 1; linear; mRNA; EST; PLN; 468 BP.
EL625123;
EST2629 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109F111, mRNA sequence.

EL625124; SV 1; linear; mRNA; EST; PLN; 657 BP.
EL625124;
EST2630 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109F121, mRNA sequence.

EL625125; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL625125;
EST2631 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109G041, mRNA sequence.

EL625126; SV 1; linear; mRNA; EST; PLN; 603 BP.
EL625126;
EST2632 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109G091, mRNA sequence.

EL625127; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL625127;
EST2633 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109G121, mRNA sequence.

EL625128; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL625128;
EST2634 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B109H111, mRNA sequence.

EL625129; SV 1; linear; mRNA; EST; PLN; 595 BP.
EL625129;
EST2635 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110A011, mRNA sequence.

EL625130; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL625130;
EST2636 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110A021, mRNA sequence.

EL625131; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL625131;
EST2637 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110A041, mRNA sequence.

EL625132; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL625132;
EST2638 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110A051, mRNA sequence.

EL625133; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL625133;
EST2639 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110A061, mRNA sequence.

EL625134; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL625134;
EST2640 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110A081, mRNA sequence.

EL625135; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL625135;
EST2641 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110A101, mRNA sequence.

EL625136; SV 1; linear; mRNA; EST; PLN; 625 BP.
EL625136;
EST2642 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110A121, mRNA sequence.

EL625137; SV 1; linear; mRNA; EST; PLN; 502 BP.
EL625137;
EST2643 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110B011, mRNA sequence.

EL625138; SV 1; linear; mRNA; EST; PLN; 623 BP.
EL625138;
EST2644 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110B031, mRNA sequence.

EL625139; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL625139;
EST2645 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110B041, mRNA sequence.

EL625140; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL625140;
EST2646 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110C051, mRNA sequence.

EL625141; SV 1; linear; mRNA; EST; PLN; 733 BP.
EL625141;
EST2647 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110D041, mRNA sequence.

EL625142; SV 1; linear; mRNA; EST; PLN; 810 BP.
EL625142;
EST2648 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110D071, mRNA sequence.

EL625143; SV 1; linear; mRNA; EST; PLN; 776 BP.
EL625143;
EST2649 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110D101, mRNA sequence.

EL625144; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL625144;
EST2650 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110D121, mRNA sequence.

EL625145; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL625145;
EST2651 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110E021, mRNA sequence.

EL625146; SV 1; linear; mRNA; EST; PLN; 778 BP.
EL625146;
EST2652 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110E081, mRNA sequence.

EL625147; SV 1; linear; mRNA; EST; PLN; 751 BP.
EL625147;
EST2653 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110E091, mRNA sequence.

EL625148; SV 1; linear; mRNA; EST; PLN; 828 BP.
EL625148;
EST2654 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110G081, mRNA sequence.

EL625149; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL625149;
EST2655 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110G091, mRNA sequence.

EL625150; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL625150;
EST2656 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110H011, mRNA sequence.

EL625151; SV 1; linear; mRNA; EST; PLN; 679 BP.
EL625151;
EST2657 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110H051, mRNA sequence.

EL625152; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL625152;
EST2658 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B110H091, mRNA sequence.

EL625153; SV 1; linear; mRNA; EST; PLN; 840 BP.
EL625153;
EST2659 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111A021, mRNA sequence.

EL625154; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL625154;
EST2660 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111A031, mRNA sequence.

EL625155; SV 1; linear; mRNA; EST; PLN; 745 BP.
EL625155;
EST2661 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111A051, mRNA sequence.

EL625156; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL625156;
EST2662 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111A061, mRNA sequence.

EL625157; SV 1; linear; mRNA; EST; PLN; 728 BP.
EL625157;
EST2663 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111A101, mRNA sequence.

EL625158; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL625158;
EST2664 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111A121, mRNA sequence.

EL625159; SV 1; linear; mRNA; EST; PLN; 622 BP.
EL625159;
EST2665 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111B021, mRNA sequence.

EL625160; SV 1; linear; mRNA; EST; PLN; 591 BP.
EL625160;
EST2666 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111B051, mRNA sequence.

EL625161; SV 1; linear; mRNA; EST; PLN; 625 BP.
EL625161;
EST2667 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111B071, mRNA sequence.

EL625162; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL625162;
EST2668 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111B081, mRNA sequence.

EL625163; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL625163;
EST2669 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111C021, mRNA sequence.

EL625164; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL625164;
EST2670 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111C071, mRNA sequence.

EL625165; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL625165;
EST2671 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111D051, mRNA sequence.

EL625166; SV 1; linear; mRNA; EST; PLN; 472 BP.
EL625166;
EST2672 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111D071, mRNA sequence.

EL625167; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL625167;
EST2673 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111D081, mRNA sequence.

EL625168; SV 1; linear; mRNA; EST; PLN; 743 BP.
EL625168;
EST2674 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111D091, mRNA sequence.

EL625169; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL625169;
EST2675 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111D111, mRNA sequence.

EL625170; SV 1; linear; mRNA; EST; PLN; 568 BP.
EL625170;
EST2676 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111D121, mRNA sequence.

EL625171; SV 1; linear; mRNA; EST; PLN; 580 BP.
EL625171;
EST2677 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111E011, mRNA sequence.

EL625172; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL625172;
EST2678 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111E021, mRNA sequence.

EL625173; SV 1; linear; mRNA; EST; PLN; 480 BP.
EL625173;
EST2679 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111E041, mRNA sequence.

EL625174; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL625174;
EST2680 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111E061, mRNA sequence.

EL625175; SV 1; linear; mRNA; EST; PLN; 628 BP.
EL625175;
EST2681 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111F031, mRNA sequence.

EL625176; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL625176;
EST2682 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111F041, mRNA sequence.

EL625177; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL625177;
EST2683 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111F071, mRNA sequence.

EL625178; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625178;
EST2684 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111G071, mRNA sequence.

EL625179; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL625179;
EST2685 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111H031, mRNA sequence.

EL625180; SV 1; linear; mRNA; EST; PLN; 839 BP.
EL625180;
EST2686 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111H051, mRNA sequence.

EL625181; SV 1; linear; mRNA; EST; PLN; 382 BP.
EL625181;
EST2687 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B111H101, mRNA sequence.

EL625182; SV 1; linear; mRNA; EST; PLN; 408 BP.
EL625182;
EST2688 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112A101, mRNA sequence.

EL625183; SV 1; linear; mRNA; EST; PLN; 729 BP.
EL625183;
EST2689 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112A111, mRNA sequence.

EL625184; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL625184;
EST2690 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112A121, mRNA sequence.

EL625185; SV 1; linear; mRNA; EST; PLN; 847 BP.
EL625185;
EST2691 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112B041, mRNA sequence.

EL625186; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL625186;
EST2692 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112B091, mRNA sequence.

EL625187; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL625187;
EST2693 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112B101, mRNA sequence.

EL625188; SV 1; linear; mRNA; EST; PLN; 858 BP.
EL625188;
EST2694 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112C031, mRNA sequence.

EL625189; SV 1; linear; mRNA; EST; PLN; 391 BP.
EL625189;
EST2695 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112C051, mRNA sequence.

EL625190; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL625190;
EST2696 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112C081, mRNA sequence.

EL625191; SV 1; linear; mRNA; EST; PLN; 379 BP.
EL625191;
EST2697 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112C121, mRNA sequence.

EL625192; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL625192;
EST2698 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112D051, mRNA sequence.

EL625193; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL625193;
EST2699 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112D071, mRNA sequence.

EL625194; SV 1; linear; mRNA; EST; PLN; 432 BP.
EL625194;
EST2700 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112D121, mRNA sequence.

EL625195; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL625195;
EST2701 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112E071, mRNA sequence.

EL625196; SV 1; linear; mRNA; EST; PLN; 824 BP.
EL625196;
EST2702 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112F011, mRNA sequence.

EL625197; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL625197;
EST2703 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112F021, mRNA sequence.

EL625198; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL625198;
EST2704 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112F041, mRNA sequence.

EL625199; SV 1; linear; mRNA; EST; PLN; 401 BP.
EL625199;
EST2705 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112F051, mRNA sequence.

EL625200; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL625200;
EST2706 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112G011, mRNA sequence.

EL625201; SV 1; linear; mRNA; EST; PLN; 466 BP.
EL625201;
EST2707 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112G101, mRNA sequence.

EL625202; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL625202;
EST2708 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B112H031, mRNA sequence.

EL625203; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL625203;
EST2709 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113A011, mRNA sequence.

EL625204; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL625204;
EST2710 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113A071, mRNA sequence.

EL625205; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL625205;
EST2711 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113B081, mRNA sequence.

EL625206; SV 1; linear; mRNA; EST; PLN; 474 BP.
EL625206;
EST2712 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113C061, mRNA sequence.

EL625207; SV 1; linear; mRNA; EST; PLN; 398 BP.
EL625207;
EST2713 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113C101, mRNA sequence.

EL625208; SV 1; linear; mRNA; EST; PLN; 376 BP.
EL625208;
EST2714 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113D041, mRNA sequence.

EL625209; SV 1; linear; mRNA; EST; PLN; 429 BP.
EL625209;
EST2715 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113D081, mRNA sequence.

EL625210; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL625210;
EST2716 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113E031, mRNA sequence.

EL625211; SV 1; linear; mRNA; EST; PLN; 430 BP.
EL625211;
EST2717 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113F061, mRNA sequence.

EL625212; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL625212;
EST2718 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113F091, mRNA sequence.

EL625213; SV 1; linear; mRNA; EST; PLN; 773 BP.
EL625213;
EST2719 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113G061, mRNA sequence.

EL625214; SV 1; linear; mRNA; EST; PLN; 716 BP.
EL625214;
EST2720 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113G111, mRNA sequence.

EL625215; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL625215;
EST2721 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113H011, mRNA sequence.

EL625216; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL625216;
EST2722 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B113H121, mRNA sequence.

EL625217; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL625217;
EST2723 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114A011, mRNA sequence.

EL625218; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL625218;
EST2724 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114A041, mRNA sequence.

EL625219; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL625219;
EST2725 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114B011, mRNA sequence.

EL625220; SV 1; linear; mRNA; EST; PLN; 790 BP.
EL625220;
EST2726 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114B081, mRNA sequence.

EL625221; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL625221;
EST2727 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114B111, mRNA sequence.

EL625222; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL625222;
EST2728 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114C021, mRNA sequence.

EL625223; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL625223;
EST2729 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114C041, mRNA sequence.

EL625224; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL625224;
EST2730 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114C061, mRNA sequence.

EL625225; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL625225;
EST2731 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114C071, mRNA sequence.

EL625226; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL625226;
EST2732 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114C101, mRNA sequence.

EL625227; SV 1; linear; mRNA; EST; PLN; 720 BP.
EL625227;
EST2733 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114D011, mRNA sequence.

EL625228; SV 1; linear; mRNA; EST; PLN; 683 BP.
EL625228;
EST2734 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114D111, mRNA sequence.

EL625229; SV 1; linear; mRNA; EST; PLN; 456 BP.
EL625229;
EST2735 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114E011, mRNA sequence.

EL625230; SV 1; linear; mRNA; EST; PLN; 712 BP.
EL625230;
EST2736 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114E031, mRNA sequence.

EL625231; SV 1; linear; mRNA; EST; PLN; 681 BP.
EL625231;
EST2737 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114E071, mRNA sequence.

EL625232; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL625232;
EST2738 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114E081, mRNA sequence.

EL625233; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL625233;
EST2739 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114F071, mRNA sequence.

EL625234; SV 1; linear; mRNA; EST; PLN; 664 BP.
EL625234;
EST2740 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114F081, mRNA sequence.

EL625235; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL625235;
EST2741 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114F101, mRNA sequence.

EL625236; SV 1; linear; mRNA; EST; PLN; 654 BP.
EL625236;
EST2742 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114F121, mRNA sequence.

EL625237; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL625237;
EST2743 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114G051, mRNA sequence.

EL625238; SV 1; linear; mRNA; EST; PLN; 468 BP.
EL625238;
EST2744 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114G071, mRNA sequence.

EL625239; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL625239;
EST2745 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114G121, mRNA sequence.

EL625240; SV 1; linear; mRNA; EST; PLN; 648 BP.
EL625240;
EST2746 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114H011, mRNA sequence.

EL625241; SV 1; linear; mRNA; EST; PLN; 713 BP.
EL625241;
EST2747 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114H111, mRNA sequence.

EL625242; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL625242;
EST2748 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B114H121, mRNA sequence.

EL625243; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL625243;
EST2749 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115A021, mRNA sequence.

EL625244; SV 1; linear; mRNA; EST; PLN; 627 BP.
EL625244;
EST2750 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115A091, mRNA sequence.

EL625245; SV 1; linear; mRNA; EST; PLN; 713 BP.
EL625245;
EST2751 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115A101, mRNA sequence.

EL625246; SV 1; linear; mRNA; EST; PLN; 826 BP.
EL625246;
EST2752 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115B021, mRNA sequence.

EL625247; SV 1; linear; mRNA; EST; PLN; 665 BP.
EL625247;
EST2753 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115B061, mRNA sequence.

EL625248; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL625248;
EST2754 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115B091, mRNA sequence.

EL625249; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL625249;
EST2755 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115C011, mRNA sequence.

EL625250; SV 1; linear; mRNA; EST; PLN; 604 BP.
EL625250;
EST2756 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115C071, mRNA sequence.

EL625251; SV 1; linear; mRNA; EST; PLN; 780 BP.
EL625251;
EST2757 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115D011, mRNA sequence.

EL625252; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL625252;
EST2758 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115D111, mRNA sequence.

EL625253; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL625253;
EST2759 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115E081, mRNA sequence.

EL625254; SV 1; linear; mRNA; EST; PLN; 722 BP.
EL625254;
EST2760 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115E091, mRNA sequence.

EL625255; SV 1; linear; mRNA; EST; PLN; 314 BP.
EL625255;
EST2761 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115E111, mRNA sequence.

EL625256; SV 1; linear; mRNA; EST; PLN; 427 BP.
EL625256;
EST2762 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115F051, mRNA sequence.

EL625257; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL625257;
EST2763 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115F081, mRNA sequence.

EL625258; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL625258;
EST2764 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115G021, mRNA sequence.

EL625259; SV 1; linear; mRNA; EST; PLN; 837 BP.
EL625259;
EST2765 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115G071, mRNA sequence.

EL625260; SV 1; linear; mRNA; EST; PLN; 776 BP.
EL625260;
EST2766 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115H041, mRNA sequence.

EL625261; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL625261;
EST2767 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B115H061, mRNA sequence.

EL625262; SV 1; linear; mRNA; EST; PLN; 433 BP.
EL625262;
EST2768 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116B031, mRNA sequence.

EL625263; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL625263;
EST2769 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116B101, mRNA sequence.

EL625264; SV 1; linear; mRNA; EST; PLN; 493 BP.
EL625264;
EST2770 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116C101, mRNA sequence.

EL625265; SV 1; linear; mRNA; EST; PLN; 456 BP.
EL625265;
EST2771 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116D041, mRNA sequence.

EL625266; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL625266;
EST2772 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116D101, mRNA sequence.

EL625267; SV 1; linear; mRNA; EST; PLN; 344 BP.
EL625267;
EST2773 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116D111, mRNA sequence.

EL625268; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL625268;
EST2774 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116D121, mRNA sequence.

EL625269; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL625269;
EST2775 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116E051, mRNA sequence.

EL625270; SV 1; linear; mRNA; EST; PLN; 239 BP.
EL625270;
EST2776 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116E071, mRNA sequence.

EL625271; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL625271;
EST2777 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116E121, mRNA sequence.

EL625272; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL625272;
EST2778 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116F011, mRNA sequence.

EL625273; SV 1; linear; mRNA; EST; PLN; 296 BP.
EL625273;
EST2779 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116F031, mRNA sequence.

EL625274; SV 1; linear; mRNA; EST; PLN; 604 BP.
EL625274;
EST2780 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116F071, mRNA sequence.

EL625275; SV 1; linear; mRNA; EST; PLN; 488 BP.
EL625275;
EST2781 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116G061, mRNA sequence.

EL625276; SV 1; linear; mRNA; EST; PLN; 394 BP.
EL625276;
EST2782 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116G081, mRNA sequence.

EL625277; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL625277;
EST2783 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116G101, mRNA sequence.

EL625278; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL625278;
EST2784 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116H051, mRNA sequence.

EL625279; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL625279;
EST2785 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B116H081, mRNA sequence.

EL625280; SV 1; linear; mRNA; EST; PLN; 525 BP.
EL625280;
EST2786 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117A021, mRNA sequence.

EL625281; SV 1; linear; mRNA; EST; PLN; 367 BP.
EL625281;
EST2787 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117A041, mRNA sequence.

EL625282; SV 1; linear; mRNA; EST; PLN; 202 BP.
EL625282;
EST2788 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117A081, mRNA sequence.

EL625283; SV 1; linear; mRNA; EST; PLN; 481 BP.
EL625283;
EST2789 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117A101, mRNA sequence.

EL625284; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL625284;
EST2790 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117A111, mRNA sequence.

EL625285; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL625285;
EST2791 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117B031, mRNA sequence.

EL625286; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL625286;
EST2792 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117B101, mRNA sequence.

EL625287; SV 1; linear; mRNA; EST; PLN; 361 BP.
EL625287;
EST2793 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117C021, mRNA sequence.

EL625288; SV 1; linear; mRNA; EST; PLN; 545 BP.
EL625288;
EST2794 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117C061, mRNA sequence.

EL625289; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL625289;
EST2795 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117C071, mRNA sequence.

EL625290; SV 1; linear; mRNA; EST; PLN; 766 BP.
EL625290;
EST2796 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117C111, mRNA sequence.

EL625291; SV 1; linear; mRNA; EST; PLN; 771 BP.
EL625291;
EST2797 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117D011, mRNA sequence.

EL625292; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL625292;
EST2798 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117D081, mRNA sequence.

EL625293; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL625293;
EST2799 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117E041, mRNA sequence.

EL625294; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL625294;
EST2800 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117E051, mRNA sequence.

EL625295; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL625295;
EST2801 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117E081, mRNA sequence.

EL625296; SV 1; linear; mRNA; EST; PLN; 731 BP.
EL625296;
EST2802 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117F021, mRNA sequence.

EL625297; SV 1; linear; mRNA; EST; PLN; 785 BP.
EL625297;
EST2803 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117F091, mRNA sequence.

EL625298; SV 1; linear; mRNA; EST; PLN; 441 BP.
EL625298;
EST2804 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117F111, mRNA sequence.

EL625299; SV 1; linear; mRNA; EST; PLN; 668 BP.
EL625299;
EST2805 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117F121, mRNA sequence.

EL625300; SV 1; linear; mRNA; EST; PLN; 745 BP.
EL625300;
EST2806 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117G011, mRNA sequence.

EL625301; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL625301;
EST2807 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117H071, mRNA sequence.

EL625302; SV 1; linear; mRNA; EST; PLN; 736 BP.
EL625302;
EST2808 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B117H121, mRNA sequence.

EL625303; SV 1; linear; mRNA; EST; PLN; 781 BP.
EL625303;
EST2809 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118A051, mRNA sequence.

EL625304; SV 1; linear; mRNA; EST; PLN; 771 BP.
EL625304;
EST2810 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118A071, mRNA sequence.

EL625305; SV 1; linear; mRNA; EST; PLN; 608 BP.
EL625305;
EST2811 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118A091, mRNA sequence.

EL625306; SV 1; linear; mRNA; EST; PLN; 674 BP.
EL625306;
EST2812 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118A111, mRNA sequence.

EL625307; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL625307;
EST2813 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118A121, mRNA sequence.

EL625308; SV 1; linear; mRNA; EST; PLN; 722 BP.
EL625308;
EST2814 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118B111, mRNA sequence.

EL625309; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL625309;
EST2815 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118C011, mRNA sequence.

EL625310; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL625310;
EST2816 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118C021, mRNA sequence.

EL625311; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL625311;
EST2817 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118C071, mRNA sequence.

EL625312; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL625312;
EST2818 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118D031, mRNA sequence.

EL625313; SV 1; linear; mRNA; EST; PLN; 567 BP.
EL625313;
EST2819 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118D041, mRNA sequence.

EL625314; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL625314;
EST2820 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118D121, mRNA sequence.

EL625315; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL625315;
EST2821 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118E011, mRNA sequence.

EL625316; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL625316;
EST2822 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118E021, mRNA sequence.

EL625317; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL625317;
EST2823 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118E041, mRNA sequence.

EL625318; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL625318;
EST2824 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118E101, mRNA sequence.

EL625319; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL625319;
EST2825 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118F041, mRNA sequence.

EL625320; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL625320;
EST2826 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118F081, mRNA sequence.

EL625321; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL625321;
EST2827 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118G041, mRNA sequence.

EL625322; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL625322;
EST2828 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118G071, mRNA sequence.

EL625323; SV 1; linear; mRNA; EST; PLN; 389 BP.
EL625323;
EST2829 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118G121, mRNA sequence.

EL625324; SV 1; linear; mRNA; EST; PLN; 372 BP.
EL625324;
EST2830 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118H031, mRNA sequence.

EL625325; SV 1; linear; mRNA; EST; PLN; 557 BP.
EL625325;
EST2831 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118H061, mRNA sequence.

EL625326; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL625326;
EST2832 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B118H121, mRNA sequence.

EL625327; SV 1; linear; mRNA; EST; PLN; 444 BP.
EL625327;
EST2833 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119A051, mRNA sequence.

EL625328; SV 1; linear; mRNA; EST; PLN; 737 BP.
EL625328;
EST2834 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119A061, mRNA sequence.

EL625329; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL625329;
EST2835 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119A101, mRNA sequence.

EL625330; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL625330;
EST2836 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119A121, mRNA sequence.

EL625331; SV 1; linear; mRNA; EST; PLN; 624 BP.
EL625331;
EST2837 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119B101, mRNA sequence.

EL625332; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL625332;
EST2838 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119C021, mRNA sequence.

EL625333; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL625333;
EST2839 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119C041, mRNA sequence.

EL625334; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL625334;
EST2840 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119E081, mRNA sequence.

EL625335; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625335;
EST2841 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119F011, mRNA sequence.

EL625336; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL625336;
EST2842 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119F041, mRNA sequence.

EL625337; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL625337;
EST2843 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119F091, mRNA sequence.

EL625338; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL625338;
EST2844 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119F111, mRNA sequence.

EL625339; SV 1; linear; mRNA; EST; PLN; 712 BP.
EL625339;
EST2845 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119F121, mRNA sequence.

EL625340; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL625340;
EST2846 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119G051, mRNA sequence.

EL625341; SV 1; linear; mRNA; EST; PLN; 488 BP.
EL625341;
EST2847 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119G101, mRNA sequence.

EL625342; SV 1; linear; mRNA; EST; PLN; 483 BP.
EL625342;
EST2848 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B119H041, mRNA sequence.

EL625343; SV 1; linear; mRNA; EST; PLN; 687 BP.
EL625343;
EST2849 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120A011, mRNA sequence.

EL625344; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL625344;
EST2850 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120A071, mRNA sequence.

EL625345; SV 1; linear; mRNA; EST; PLN; 716 BP.
EL625345;
EST2851 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120A111, mRNA sequence.

EL625346; SV 1; linear; mRNA; EST; PLN; 615 BP.
EL625346;
EST2852 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120B021, mRNA sequence.

EL625347; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL625347;
EST2853 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120B031, mRNA sequence.

EL625348; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL625348;
EST2854 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120C031, mRNA sequence.

EL625349; SV 1; linear; mRNA; EST; PLN; 550 BP.
EL625349;
EST2855 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120C041, mRNA sequence.

EL625350; SV 1; linear; mRNA; EST; PLN; 747 BP.
EL625350;
EST2856 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120C111, mRNA sequence.

EL625351; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625351;
EST2857 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120D011, mRNA sequence.

EL625352; SV 1; linear; mRNA; EST; PLN; 194 BP.
EL625352;
EST2858 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120E041, mRNA sequence.

EL625353; SV 1; linear; mRNA; EST; PLN; 792 BP.
EL625353;
EST2859 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120E061, mRNA sequence.

EL625354; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL625354;
EST2860 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120E071, mRNA sequence.

EL625355; SV 1; linear; mRNA; EST; PLN; 715 BP.
EL625355;
EST2861 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120E091, mRNA sequence.

EL625356; SV 1; linear; mRNA; EST; PLN; 398 BP.
EL625356;
EST2862 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120E121, mRNA sequence.

EL625357; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL625357;
EST2863 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120F011, mRNA sequence.

EL625358; SV 1; linear; mRNA; EST; PLN; 595 BP.
EL625358;
EST2864 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120G021, mRNA sequence.

EL625359; SV 1; linear; mRNA; EST; PLN; 394 BP.
EL625359;
EST2865 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120H021, mRNA sequence.

EL625360; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL625360;
EST2866 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120H051, mRNA sequence.

EL625361; SV 1; linear; mRNA; EST; PLN; 615 BP.
EL625361;
EST2867 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B120H101, mRNA sequence.

EL625362; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL625362;
EST2868 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121A011, mRNA sequence.

EL625363; SV 1; linear; mRNA; EST; PLN; 721 BP.
EL625363;
EST2869 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121A041, mRNA sequence.

EL625364; SV 1; linear; mRNA; EST; PLN; 248 BP.
EL625364;
EST2870 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121B091, mRNA sequence.

EL625365; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL625365;
EST2871 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121B101, mRNA sequence.

EL625366; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL625366;
EST2872 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121C021, mRNA sequence.

EL625367; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL625367;
EST2873 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121C031, mRNA sequence.

EL625368; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL625368;
EST2874 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121C041, mRNA sequence.

EL625369; SV 1; linear; mRNA; EST; PLN; 363 BP.
EL625369;
EST2875 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121C101, mRNA sequence.

EL625370; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL625370;
EST2876 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121D021, mRNA sequence.

EL625371; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL625371;
EST2877 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121D091, mRNA sequence.

EL625372; SV 1; linear; mRNA; EST; PLN; 397 BP.
EL625372;
EST2878 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121D101, mRNA sequence.

EL625373; SV 1; linear; mRNA; EST; PLN; 397 BP.
EL625373;
EST2879 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121E101, mRNA sequence.

EL625374; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL625374;
EST2880 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121E111, mRNA sequence.

EL625375; SV 1; linear; mRNA; EST; PLN; 424 BP.
EL625375;
EST2881 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121F021, mRNA sequence.

EL625376; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL625376;
EST2882 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121F031, mRNA sequence.

EL625377; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL625377;
EST2883 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121F051, mRNA sequence.

EL625378; SV 1; linear; mRNA; EST; PLN; 338 BP.
EL625378;
EST2884 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121F091, mRNA sequence.

EL625379; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL625379;
EST2885 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121F111, mRNA sequence.

EL625380; SV 1; linear; mRNA; EST; PLN; 630 BP.
EL625380;
EST2886 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121H051, mRNA sequence.

EL625381; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL625381;
EST2887 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121H091, mRNA sequence.

EL625382; SV 1; linear; mRNA; EST; PLN; 432 BP.
EL625382;
EST2888 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B121H101, mRNA sequence.

EL625383; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL625383;
EST2889 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122A081, mRNA sequence.

EL625384; SV 1; linear; mRNA; EST; PLN; 405 BP.
EL625384;
EST2890 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122A121, mRNA sequence.

EL625385; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL625385;
EST2891 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122B061, mRNA sequence.

EL625386; SV 1; linear; mRNA; EST; PLN; 399 BP.
EL625386;
EST2892 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122B111, mRNA sequence.

EL625387; SV 1; linear; mRNA; EST; PLN; 282 BP.
EL625387;
EST2893 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122C061, mRNA sequence.

EL625388; SV 1; linear; mRNA; EST; PLN; 455 BP.
EL625388;
EST2894 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122C081, mRNA sequence.

EL625389; SV 1; linear; mRNA; EST; PLN; 442 BP.
EL625389;
EST2895 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122D081, mRNA sequence.

EL625390; SV 1; linear; mRNA; EST; PLN; 255 BP.
EL625390;
EST2896 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122D091, mRNA sequence.

EL625391; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL625391;
EST2897 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122D121, mRNA sequence.

EL625392; SV 1; linear; mRNA; EST; PLN; 364 BP.
EL625392;
EST2898 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122E031, mRNA sequence.

EL625393; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL625393;
EST2899 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122E051, mRNA sequence.

EL625394; SV 1; linear; mRNA; EST; PLN; 447 BP.
EL625394;
EST2900 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122F051, mRNA sequence.

EL625395; SV 1; linear; mRNA; EST; PLN; 407 BP.
EL625395;
EST2901 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122H011, mRNA sequence.

EL625396; SV 1; linear; mRNA; EST; PLN; 391 BP.
EL625396;
EST2902 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122H041, mRNA sequence.

EL625397; SV 1; linear; mRNA; EST; PLN; 422 BP.
EL625397;
EST2903 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122H051, mRNA sequence.

EL625398; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL625398;
EST2904 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122H071, mRNA sequence.

EL625399; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL625399;
EST2905 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122H081, mRNA sequence.

EL625400; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL625400;
EST2906 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B122H111, mRNA sequence.

EL625401; SV 1; linear; mRNA; EST; PLN; 528 BP.
EL625401;
EST2907 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123A031, mRNA sequence.

EL625402; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL625402;
EST2908 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123A111, mRNA sequence.

EL625403; SV 1; linear; mRNA; EST; PLN; 414 BP.
EL625403;
EST2909 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123A121, mRNA sequence.

EL625404; SV 1; linear; mRNA; EST; PLN; 428 BP.
EL625404;
EST2910 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123B021, mRNA sequence.

EL625405; SV 1; linear; mRNA; EST; PLN; 311 BP.
EL625405;
EST2911 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123B071, mRNA sequence.

EL625406; SV 1; linear; mRNA; EST; PLN; 362 BP.
EL625406;
EST2912 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123C021, mRNA sequence.

EL625407; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL625407;
EST2913 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123C051, mRNA sequence.

EL625408; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL625408;
EST2914 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123C111, mRNA sequence.

EL625409; SV 1; linear; mRNA; EST; PLN; 415 BP.
EL625409;
EST2915 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123D011, mRNA sequence.

EL625410; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL625410;
EST2916 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123D061, mRNA sequence.

EL625411; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL625411;
EST2917 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123D071, mRNA sequence.

EL625412; SV 1; linear; mRNA; EST; PLN; 502 BP.
EL625412;
EST2918 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123D101, mRNA sequence.

EL625413; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL625413;
EST2919 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123D111, mRNA sequence.

EL625414; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL625414;
EST2920 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123F031, mRNA sequence.

EL625415; SV 1; linear; mRNA; EST; PLN; 790 BP.
EL625415;
EST2921 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123F051, mRNA sequence.

EL625416; SV 1; linear; mRNA; EST; PLN; 720 BP.
EL625416;
EST2922 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123F061, mRNA sequence.

EL625417; SV 1; linear; mRNA; EST; PLN; 733 BP.
EL625417;
EST2923 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123F071, mRNA sequence.

EL625418; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL625418;
EST2924 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123G041, mRNA sequence.

EL625419; SV 1; linear; mRNA; EST; PLN; 709 BP.
EL625419;
EST2925 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123G121, mRNA sequence.

EL625420; SV 1; linear; mRNA; EST; PLN; 776 BP.
EL625420;
EST2926 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123H011, mRNA sequence.

EL625421; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL625421;
EST2927 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B123H091, mRNA sequence.

EL625422; SV 1; linear; mRNA; EST; PLN; 647 BP.
EL625422;
EST2928 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124A011, mRNA sequence.

EL625423; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL625423;
EST2929 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124A021, mRNA sequence.

EL625424; SV 1; linear; mRNA; EST; PLN; 773 BP.
EL625424;
EST2930 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124A091, mRNA sequence.

EL625425; SV 1; linear; mRNA; EST; PLN; 335 BP.
EL625425;
EST2931 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124A101, mRNA sequence.

EL625426; SV 1; linear; mRNA; EST; PLN; 640 BP.
EL625426;
EST2932 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124C011, mRNA sequence.

EL625427; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL625427;
EST2933 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124C021, mRNA sequence.

EL625428; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL625428;
EST2934 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124D041, mRNA sequence.

EL625429; SV 1; linear; mRNA; EST; PLN; 377 BP.
EL625429;
EST2935 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124D051, mRNA sequence.

EL625430; SV 1; linear; mRNA; EST; PLN; 649 BP.
EL625430;
EST2936 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124D121, mRNA sequence.

EL625431; SV 1; linear; mRNA; EST; PLN; 663 BP.
EL625431;
EST2937 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124E031, mRNA sequence.

EL625432; SV 1; linear; mRNA; EST; PLN; 777 BP.
EL625432;
EST2938 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124E051, mRNA sequence.

EL625433; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL625433;
EST2939 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124E061, mRNA sequence.

EL625434; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL625434;
EST2940 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124E091, mRNA sequence.

EL625435; SV 1; linear; mRNA; EST; PLN; 829 BP.
EL625435;
EST2941 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124E111, mRNA sequence.

EL625436; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL625436;
EST2942 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124F031, mRNA sequence.

EL625437; SV 1; linear; mRNA; EST; PLN; 653 BP.
EL625437;
EST2943 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124F041, mRNA sequence.

EL625438; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL625438;
EST2944 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124F051, mRNA sequence.

EL625439; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625439;
EST2945 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124F061, mRNA sequence.

EL625440; SV 1; linear; mRNA; EST; PLN; 291 BP.
EL625440;
EST2946 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124G011, mRNA sequence.

EL625441; SV 1; linear; mRNA; EST; PLN; 776 BP.
EL625441;
EST2947 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124G121, mRNA sequence.

EL625442; SV 1; linear; mRNA; EST; PLN; 324 BP.
EL625442;
EST2948 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B124H081, mRNA sequence.

EL625443; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL625443;
EST2949 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125A041, mRNA sequence.

EL625444; SV 1; linear; mRNA; EST; PLN; 397 BP.
EL625444;
EST2950 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125A051, mRNA sequence.

EL625445; SV 1; linear; mRNA; EST; PLN; 400 BP.
EL625445;
EST2951 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125A101, mRNA sequence.

EL625446; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL625446;
EST2952 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125B061, mRNA sequence.

EL625447; SV 1; linear; mRNA; EST; PLN; 225 BP.
EL625447;
EST2953 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125B071, mRNA sequence.

EL625448; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL625448;
EST2954 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125B081, mRNA sequence.

EL625449; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL625449;
EST2955 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125B121, mRNA sequence.

EL625450; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL625450;
EST2956 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125C041, mRNA sequence.

EL625451; SV 1; linear; mRNA; EST; PLN; 819 BP.
EL625451;
EST2957 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125C071, mRNA sequence.

EL625452; SV 1; linear; mRNA; EST; PLN; 746 BP.
EL625452;
EST2958 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125C101, mRNA sequence.

EL625453; SV 1; linear; mRNA; EST; PLN; 752 BP.
EL625453;
EST2959 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125C121, mRNA sequence.

EL625454; SV 1; linear; mRNA; EST; PLN; 722 BP.
EL625454;
EST2960 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125D011, mRNA sequence.

EL625455; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL625455;
EST2961 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125D021, mRNA sequence.

EL625456; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL625456;
EST2962 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125D031, mRNA sequence.

EL625457; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL625457;
EST2963 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125D041, mRNA sequence.

EL625458; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL625458;
EST2964 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125D101, mRNA sequence.

EL625459; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL625459;
EST2965 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125E071, mRNA sequence.

EL625460; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL625460;
EST2966 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125E101, mRNA sequence.

EL625461; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL625461;
EST2967 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125E111, mRNA sequence.

EL625462; SV 1; linear; mRNA; EST; PLN; 431 BP.
EL625462;
EST2968 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125F101, mRNA sequence.

EL625463; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL625463;
EST2969 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125G011, mRNA sequence.

EL625464; SV 1; linear; mRNA; EST; PLN; 530 BP.
EL625464;
EST2970 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125G061, mRNA sequence.

EL625465; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL625465;
EST2971 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125G111, mRNA sequence.

EL625466; SV 1; linear; mRNA; EST; PLN; 632 BP.
EL625466;
EST2972 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B125H021, mRNA sequence.

EL625467; SV 1; linear; mRNA; EST; PLN; 360 BP.
EL625467;
EST2973 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126A011, mRNA sequence.

EL625468; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL625468;
EST2974 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126A031, mRNA sequence.

EL625469; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL625469;
EST2975 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126A041, mRNA sequence.

EL625470; SV 1; linear; mRNA; EST; PLN; 746 BP.
EL625470;
EST2976 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126A121, mRNA sequence.

EL625471; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL625471;
EST2977 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126B021, mRNA sequence.

EL625472; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL625472;
EST2978 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126B041, mRNA sequence.

EL625473; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL625473;
EST2979 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126B111, mRNA sequence.

EL625474; SV 1; linear; mRNA; EST; PLN; 682 BP.
EL625474;
EST2980 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126C041, mRNA sequence.

EL625475; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL625475;
EST2981 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126D021, mRNA sequence.

EL625476; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL625476;
EST2982 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126E101, mRNA sequence.

EL625477; SV 1; linear; mRNA; EST; PLN; 186 BP.
EL625477;
EST2983 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126F061, mRNA sequence.

EL625478; SV 1; linear; mRNA; EST; PLN; 507 BP.
EL625478;
EST2984 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126F121, mRNA sequence.

EL625479; SV 1; linear; mRNA; EST; PLN; 491 BP.
EL625479;
EST2985 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126G031, mRNA sequence.

EL625480; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL625480;
EST2986 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126G041, mRNA sequence.

EL625481; SV 1; linear; mRNA; EST; PLN; 870 BP.
EL625481;
EST2987 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126G091, mRNA sequence.

EL625482; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL625482;
EST2988 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126G101, mRNA sequence.

EL625483; SV 1; linear; mRNA; EST; PLN; 476 BP.
EL625483;
EST2989 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126G111, mRNA sequence.

EL625484; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL625484;
EST2990 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126H021, mRNA sequence.

EL625485; SV 1; linear; mRNA; EST; PLN; 634 BP.
EL625485;
EST2991 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126H031, mRNA sequence.

EL625486; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL625486;
EST2992 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B126H071, mRNA sequence.

EL625487; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL625487;
EST2993 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B127A031, mRNA sequence.

EL625488; SV 1; linear; mRNA; EST; PLN; 431 BP.
EL625488;
EST2994 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B127A061, mRNA sequence.

EL625489; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL625489;
EST2995 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B127A121, mRNA sequence.

EL625490; SV 1; linear; mRNA; EST; PLN; 498 BP.
EL625490;
EST2996 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B127C061, mRNA sequence.

EL625491; SV 1; linear; mRNA; EST; PLN; 669 BP.
EL625491;
EST2997 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B127C071, mRNA sequence.

EL625492; SV 1; linear; mRNA; EST; PLN; 647 BP.
EL625492;
EST2998 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B127F061, mRNA sequence.

EL625493; SV 1; linear; mRNA; EST; PLN; 503 BP.
EL625493;
EST2999 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B127G021, mRNA sequence.

EL625494; SV 1; linear; mRNA; EST; PLN; 488 BP.
EL625494;
EST3000 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B127G091, mRNA sequence.

EL625495; SV 1; linear; mRNA; EST; PLN; 897 BP.
EL625495;
EST3001 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128A091, mRNA sequence.

EL625496; SV 1; linear; mRNA; EST; PLN; 378 BP.
EL625496;
EST3002 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128B031, mRNA sequence.

EL625497; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL625497;
EST3003 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128C061, mRNA sequence.

EL625498; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL625498;
EST3004 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128C071, mRNA sequence.

EL625499; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL625499;
EST3005 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128D011, mRNA sequence.

EL625500; SV 1; linear; mRNA; EST; PLN; 507 BP.
EL625500;
EST3006 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128D031, mRNA sequence.

EL625501; SV 1; linear; mRNA; EST; PLN; 492 BP.
EL625501;
EST3007 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128D081, mRNA sequence.

EL625502; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL625502;
EST3008 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128E031, mRNA sequence.

EL625503; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL625503;
EST3009 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128E081, mRNA sequence.

EL625504; SV 1; linear; mRNA; EST; PLN; 608 BP.
EL625504;
EST3010 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128F061, mRNA sequence.

EL625505; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL625505;
EST3011 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128F071, mRNA sequence.

EL625506; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL625506;
EST3012 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128G051, mRNA sequence.

EL625507; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL625507;
EST3013 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128G071, mRNA sequence.

EL625508; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL625508;
EST3014 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128G101, mRNA sequence.

EL625509; SV 1; linear; mRNA; EST; PLN; 587 BP.
EL625509;
EST3015 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128H011, mRNA sequence.

EL625510; SV 1; linear; mRNA; EST; PLN; 474 BP.
EL625510;
EST3016 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128H041, mRNA sequence.

EL625511; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL625511;
EST3017 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128H091, mRNA sequence.

EL625512; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL625512;
EST3018 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B128H121, mRNA sequence.

EL625513; SV 1; linear; mRNA; EST; PLN; 552 BP.
EL625513;
EST3019 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129A071, mRNA sequence.

EL625514; SV 1; linear; mRNA; EST; PLN; 411 BP.
EL625514;
EST3020 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129A111, mRNA sequence.

EL625515; SV 1; linear; mRNA; EST; PLN; 438 BP.
EL625515;
EST3021 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129B031, mRNA sequence.

EL625516; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL625516;
EST3022 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129B081, mRNA sequence.

EL625517; SV 1; linear; mRNA; EST; PLN; 838 BP.
EL625517;
EST3023 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129B091, mRNA sequence.

EL625518; SV 1; linear; mRNA; EST; PLN; 620 BP.
EL625518;
EST3024 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129B101, mRNA sequence.

EL625519; SV 1; linear; mRNA; EST; PLN; 632 BP.
EL625519;
EST3025 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129C061, mRNA sequence.

EL625520; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL625520;
EST3026 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129C081, mRNA sequence.

EL625521; SV 1; linear; mRNA; EST; PLN; 663 BP.
EL625521;
EST3027 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129C101, mRNA sequence.

EL625522; SV 1; linear; mRNA; EST; PLN; 735 BP.
EL625522;
EST3028 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129D041, mRNA sequence.

EL625523; SV 1; linear; mRNA; EST; PLN; 725 BP.
EL625523;
EST3029 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129D061, mRNA sequence.

EL625524; SV 1; linear; mRNA; EST; PLN; 803 BP.
EL625524;
EST3030 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129E051, mRNA sequence.

EL625525; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL625525;
EST3031 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129E061, mRNA sequence.

EL625526; SV 1; linear; mRNA; EST; PLN; 716 BP.
EL625526;
EST3032 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129F051, mRNA sequence.

EL625527; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL625527;
EST3033 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129G031, mRNA sequence.

EL625528; SV 1; linear; mRNA; EST; PLN; 715 BP.
EL625528;
EST3034 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129G061, mRNA sequence.

EL625529; SV 1; linear; mRNA; EST; PLN; 722 BP.
EL625529;
EST3035 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129G071, mRNA sequence.

EL625530; SV 1; linear; mRNA; EST; PLN; 712 BP.
EL625530;
EST3036 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129G101, mRNA sequence.

EL625531; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL625531;
EST3037 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B129H041, mRNA sequence.

EL625532; SV 1; linear; mRNA; EST; PLN; 254 BP.
EL625532;
EST3038 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130D111, mRNA sequence.

EL625533; SV 1; linear; mRNA; EST; PLN; 276 BP.
EL625533;
EST3039 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130E071, mRNA sequence.

EL625534; SV 1; linear; mRNA; EST; PLN; 225 BP.
EL625534;
EST3040 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130E081, mRNA sequence.

EL625535; SV 1; linear; mRNA; EST; PLN; 879 BP.
EL625535;
EST3041 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130E091, mRNA sequence.

EL625536; SV 1; linear; mRNA; EST; PLN; 222 BP.
EL625536;
EST3042 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130E101, mRNA sequence.

EL625537; SV 1; linear; mRNA; EST; PLN; 289 BP.
EL625537;
EST3043 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130F021, mRNA sequence.

EL625538; SV 1; linear; mRNA; EST; PLN; 245 BP.
EL625538;
EST3044 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130F041, mRNA sequence.

EL625539; SV 1; linear; mRNA; EST; PLN; 773 BP.
EL625539;
EST3045 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130F101, mRNA sequence.

EL625540; SV 1; linear; mRNA; EST; PLN; 838 BP.
EL625540;
EST3046 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130F111, mRNA sequence.

EL625541; SV 1; linear; mRNA; EST; PLN; 502 BP.
EL625541;
EST3047 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130G031, mRNA sequence.

EL625542; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL625542;
EST3048 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130G051, mRNA sequence.

EL625543; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL625543;
EST3049 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130G111, mRNA sequence.

EL625544; SV 1; linear; mRNA; EST; PLN; 500 BP.
EL625544;
EST3050 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130G121, mRNA sequence.

EL625545; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL625545;
EST3051 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B130H121, mRNA sequence.

EL625546; SV 1; linear; mRNA; EST; PLN; 473 BP.
EL625546;
EST3052 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131A011, mRNA sequence.

EL625547; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL625547;
EST3053 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131B071, mRNA sequence.

EL625548; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL625548;
EST3054 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131C021, mRNA sequence.

EL625549; SV 1; linear; mRNA; EST; PLN; 382 BP.
EL625549;
EST3055 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131C031, mRNA sequence.

EL625550; SV 1; linear; mRNA; EST; PLN; 463 BP.
EL625550;
EST3056 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131C081, mRNA sequence.

EL625551; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL625551;
EST3057 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131C111, mRNA sequence.

EL625552; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL625552;
EST3058 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131D051, mRNA sequence.

EL625553; SV 1; linear; mRNA; EST; PLN; 393 BP.
EL625553;
EST3059 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131D061, mRNA sequence.

EL625554; SV 1; linear; mRNA; EST; PLN; 375 BP.
EL625554;
EST3060 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131D071, mRNA sequence.

EL625555; SV 1; linear; mRNA; EST; PLN; 385 BP.
EL625555;
EST3061 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131D081, mRNA sequence.

EL625556; SV 1; linear; mRNA; EST; PLN; 465 BP.
EL625556;
EST3062 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131E031, mRNA sequence.

EL625557; SV 1; linear; mRNA; EST; PLN; 401 BP.
EL625557;
EST3063 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131E041, mRNA sequence.

EL625558; SV 1; linear; mRNA; EST; PLN; 480 BP.
EL625558;
EST3064 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131E081, mRNA sequence.

EL625559; SV 1; linear; mRNA; EST; PLN; 595 BP.
EL625559;
EST3065 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131E091, mRNA sequence.

EL625560; SV 1; linear; mRNA; EST; PLN; 387 BP.
EL625560;
EST3066 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131E101, mRNA sequence.

EL625561; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL625561;
EST3067 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131E121, mRNA sequence.

EL625562; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL625562;
EST3068 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131F091, mRNA sequence.

EL625563; SV 1; linear; mRNA; EST; PLN; 615 BP.
EL625563;
EST3069 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131H041, mRNA sequence.

EL625564; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL625564;
EST3070 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131H081, mRNA sequence.

EL625565; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL625565;
EST3071 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B131H091, mRNA sequence.

EL625566; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL625566;
EST3072 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132A061, mRNA sequence.

EL625567; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL625567;
EST3073 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132A121, mRNA sequence.

EL625568; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL625568;
EST3074 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132B081, mRNA sequence.

EL625569; SV 1; linear; mRNA; EST; PLN; 672 BP.
EL625569;
EST3075 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132C031, mRNA sequence.

EL625570; SV 1; linear; mRNA; EST; PLN; 730 BP.
EL625570;
EST3076 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132C111, mRNA sequence.

EL625571; SV 1; linear; mRNA; EST; PLN; 831 BP.
EL625571;
EST3077 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132D011, mRNA sequence.

EL625572; SV 1; linear; mRNA; EST; PLN; 200 BP.
EL625572;
EST3078 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132D071, mRNA sequence.

EL625573; SV 1; linear; mRNA; EST; PLN; 673 BP.
EL625573;
EST3079 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132E031, mRNA sequence.

EL625574; SV 1; linear; mRNA; EST; PLN; 770 BP.
EL625574;
EST3080 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132E041, mRNA sequence.

EL625575; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL625575;
EST3081 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132E071, mRNA sequence.

EL625576; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL625576;
EST3082 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132E091, mRNA sequence.

EL625577; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL625577;
EST3083 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132E101, mRNA sequence.

EL625578; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL625578;
EST3084 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132E121, mRNA sequence.

EL625579; SV 1; linear; mRNA; EST; PLN; 736 BP.
EL625579;
EST3085 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132F121, mRNA sequence.

EL625580; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL625580;
EST3086 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132G021, mRNA sequence.

EL625581; SV 1; linear; mRNA; EST; PLN; 656 BP.
EL625581;
EST3087 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132G051, mRNA sequence.

EL625582; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL625582;
EST3088 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132H011, mRNA sequence.

EL625583; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL625583;
EST3089 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132H021, mRNA sequence.

EL625584; SV 1; linear; mRNA; EST; PLN; 488 BP.
EL625584;
EST3090 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132H031, mRNA sequence.

EL625585; SV 1; linear; mRNA; EST; PLN; 458 BP.
EL625585;
EST3091 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132H071, mRNA sequence.

EL625586; SV 1; linear; mRNA; EST; PLN; 495 BP.
EL625586;
EST3092 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132H081, mRNA sequence.

EL625587; SV 1; linear; mRNA; EST; PLN; 653 BP.
EL625587;
EST3093 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B132H111, mRNA sequence.

EL625588; SV 1; linear; mRNA; EST; PLN; 358 BP.
EL625588;
EST3094 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133A051, mRNA sequence.

EL625589; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL625589;
EST3095 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133A061, mRNA sequence.

EL625590; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL625590;
EST3096 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133B011, mRNA sequence.

EL625591; SV 1; linear; mRNA; EST; PLN; 637 BP.
EL625591;
EST3097 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133B041, mRNA sequence.

EL625592; SV 1; linear; mRNA; EST; PLN; 631 BP.
EL625592;
EST3098 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133B061, mRNA sequence.

EL625593; SV 1; linear; mRNA; EST; PLN; 650 BP.
EL625593;
EST3099 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133B091, mRNA sequence.

EL625594; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL625594;
EST3100 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133C021, mRNA sequence.

EL625595; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL625595;
EST3101 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133C031, mRNA sequence.

EL625596; SV 1; linear; mRNA; EST; PLN; 488 BP.
EL625596;
EST3102 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133C101, mRNA sequence.

EL625597; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL625597;
EST3103 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133D031, mRNA sequence.

EL625598; SV 1; linear; mRNA; EST; PLN; 483 BP.
EL625598;
EST3104 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133D041, mRNA sequence.

EL625599; SV 1; linear; mRNA; EST; PLN; 726 BP.
EL625599;
EST3105 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133D061, mRNA sequence.

EL625600; SV 1; linear; mRNA; EST; PLN; 458 BP.
EL625600;
EST3106 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133E041, mRNA sequence.

EL625601; SV 1; linear; mRNA; EST; PLN; 602 BP.
EL625601;
EST3107 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133E101, mRNA sequence.

EL625602; SV 1; linear; mRNA; EST; PLN; 469 BP.
EL625602;
EST3108 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133F051, mRNA sequence.

EL625603; SV 1; linear; mRNA; EST; PLN; 385 BP.
EL625603;
EST3109 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133F071, mRNA sequence.

EL625604; SV 1; linear; mRNA; EST; PLN; 550 BP.
EL625604;
EST3110 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133G011, mRNA sequence.

EL625605; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL625605;
EST3111 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133G051, mRNA sequence.

EL625606; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL625606;
EST3112 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133H081, mRNA sequence.

EL625607; SV 1; linear; mRNA; EST; PLN; 452 BP.
EL625607;
EST3113 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B133H091, mRNA sequence.

EL625608; SV 1; linear; mRNA; EST; PLN; 507 BP.
EL625608;
EST3114 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134A031, mRNA sequence.

EL625609; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL625609;
EST3115 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134A051, mRNA sequence.

EL625610; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL625610;
EST3116 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134B031, mRNA sequence.

EL625611; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL625611;
EST3117 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134B091, mRNA sequence.

EL625612; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL625612;
EST3118 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134B111, mRNA sequence.

EL625613; SV 1; linear; mRNA; EST; PLN; 750 BP.
EL625613;
EST3119 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134C041, mRNA sequence.

EL625614; SV 1; linear; mRNA; EST; PLN; 732 BP.
EL625614;
EST3120 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134C061, mRNA sequence.

EL625615; SV 1; linear; mRNA; EST; PLN; 791 BP.
EL625615;
EST3121 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134C071, mRNA sequence.

EL625616; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL625616;
EST3122 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134D011, mRNA sequence.

EL625617; SV 1; linear; mRNA; EST; PLN; 861 BP.
EL625617;
EST3123 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134E031, mRNA sequence.

EL625618; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL625618;
EST3124 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134E041, mRNA sequence.

EL625619; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL625619;
EST3125 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134E051, mRNA sequence.

EL625620; SV 1; linear; mRNA; EST; PLN; 913 BP.
EL625620;
EST3126 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134E061, mRNA sequence.

EL625621; SV 1; linear; mRNA; EST; PLN; 450 BP.
EL625621;
EST3127 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134G031, mRNA sequence.

EL625622; SV 1; linear; mRNA; EST; PLN; 625 BP.
EL625622;
EST3128 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134G061, mRNA sequence.

EL625623; SV 1; linear; mRNA; EST; PLN; 652 BP.
EL625623;
EST3129 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134G071, mRNA sequence.

EL625624; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL625624;
EST3130 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134G101, mRNA sequence.

EL625625; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL625625;
EST3131 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134G121, mRNA sequence.

EL625626; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL625626;
EST3132 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134H061, mRNA sequence.

EL625627; SV 1; linear; mRNA; EST; PLN; 431 BP.
EL625627;
EST3133 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134H071, mRNA sequence.

EL625628; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL625628;
EST3134 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134H111, mRNA sequence.

EL625629; SV 1; linear; mRNA; EST; PLN; 571 BP.
EL625629;
EST3135 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B134H121, mRNA sequence.

EL625630; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL625630;
EST3136 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135A031, mRNA sequence.

EL625631; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL625631;
EST3137 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135B021, mRNA sequence.

EL625632; SV 1; linear; mRNA; EST; PLN; 495 BP.
EL625632;
EST3138 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135B061, mRNA sequence.

EL625633; SV 1; linear; mRNA; EST; PLN; 508 BP.
EL625633;
EST3139 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135B081, mRNA sequence.

EL625634; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL625634;
EST3140 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135B121, mRNA sequence.

EL625635; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL625635;
EST3141 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135C031, mRNA sequence.

EL625636; SV 1; linear; mRNA; EST; PLN; 533 BP.
EL625636;
EST3142 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135C061, mRNA sequence.

EL625637; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL625637;
EST3143 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135C121, mRNA sequence.

EL625638; SV 1; linear; mRNA; EST; PLN; 450 BP.
EL625638;
EST3144 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135D061, mRNA sequence.

EL625639; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL625639;
EST3145 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135D101, mRNA sequence.

EL625640; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL625640;
EST3146 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135E061, mRNA sequence.

EL625641; SV 1; linear; mRNA; EST; PLN; 326 BP.
EL625641;
EST3147 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135E081, mRNA sequence.

EL625642; SV 1; linear; mRNA; EST; PLN; 615 BP.
EL625642;
EST3148 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135E111, mRNA sequence.

EL625643; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL625643;
EST3149 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135F111, mRNA sequence.

EL625644; SV 1; linear; mRNA; EST; PLN; 676 BP.
EL625644;
EST3150 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135G021, mRNA sequence.

EL625645; SV 1; linear; mRNA; EST; PLN; 287 BP.
EL625645;
EST3151 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135H011, mRNA sequence.

EL625646; SV 1; linear; mRNA; EST; PLN; 338 BP.
EL625646;
EST3152 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135H051, mRNA sequence.

EL625647; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL625647;
EST3153 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135H071, mRNA sequence.

EL625648; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL625648;
EST3154 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B135H121, mRNA sequence.

EL625649; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL625649;
EST3155 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136A021, mRNA sequence.

EL625650; SV 1; linear; mRNA; EST; PLN; 866 BP.
EL625650;
EST3156 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136A071, mRNA sequence.

EL625651; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL625651;
EST3157 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136B011, mRNA sequence.

EL625652; SV 1; linear; mRNA; EST; PLN; 463 BP.
EL625652;
EST3158 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136B031, mRNA sequence.

EL625653; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL625653;
EST3159 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136B081, mRNA sequence.

EL625654; SV 1; linear; mRNA; EST; PLN; 736 BP.
EL625654;
EST3160 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136B091, mRNA sequence.

EL625655; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL625655;
EST3161 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136C011, mRNA sequence.

EL625656; SV 1; linear; mRNA; EST; PLN; 281 BP.
EL625656;
EST3162 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136C051, mRNA sequence.

EL625657; SV 1; linear; mRNA; EST; PLN; 388 BP.
EL625657;
EST3163 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136D021, mRNA sequence.

EL625658; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL625658;
EST3164 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136D071, mRNA sequence.

EL625659; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL625659;
EST3165 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136D091, mRNA sequence.

EL625660; SV 1; linear; mRNA; EST; PLN; 483 BP.
EL625660;
EST3166 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136E081, mRNA sequence.

EL625661; SV 1; linear; mRNA; EST; PLN; 396 BP.
EL625661;
EST3167 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136E121, mRNA sequence.

EL625662; SV 1; linear; mRNA; EST; PLN; 298 BP.
EL625662;
EST3168 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136F041, mRNA sequence.

EL625663; SV 1; linear; mRNA; EST; PLN; 408 BP.
EL625663;
EST3169 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136G011, mRNA sequence.

EL625664; SV 1; linear; mRNA; EST; PLN; 410 BP.
EL625664;
EST3170 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136G051, mRNA sequence.

EL625665; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL625665;
EST3171 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136G091, mRNA sequence.

EL625666; SV 1; linear; mRNA; EST; PLN; 370 BP.
EL625666;
EST3172 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136H011, mRNA sequence.

EL625667; SV 1; linear; mRNA; EST; PLN; 859 BP.
EL625667;
EST3173 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136H031, mRNA sequence.

EL625668; SV 1; linear; mRNA; EST; PLN; 726 BP.
EL625668;
EST3174 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136H071, mRNA sequence.

EL625669; SV 1; linear; mRNA; EST; PLN; 849 BP.
EL625669;
EST3175 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B136H081, mRNA sequence.

EL625670; SV 1; linear; mRNA; EST; PLN; 370 BP.
EL625670;
EST3176 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137A041, mRNA sequence.

EL625671; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL625671;
EST3177 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137A061, mRNA sequence.

EL625672; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL625672;
EST3178 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137A111, mRNA sequence.

EL625673; SV 1; linear; mRNA; EST; PLN; 569 BP.
EL625673;
EST3179 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137B011, mRNA sequence.

EL625674; SV 1; linear; mRNA; EST; PLN; 282 BP.
EL625674;
EST3180 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137B051, mRNA sequence.

EL625675; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL625675;
EST3181 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137B071, mRNA sequence.

EL625676; SV 1; linear; mRNA; EST; PLN; 517 BP.
EL625676;
EST3182 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137B091, mRNA sequence.

EL625677; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL625677;
EST3183 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137C121, mRNA sequence.

EL625678; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL625678;
EST3184 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137D021, mRNA sequence.

EL625679; SV 1; linear; mRNA; EST; PLN; 452 BP.
EL625679;
EST3185 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137D051, mRNA sequence.

EL625680; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL625680;
EST3186 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137D071, mRNA sequence.

EL625681; SV 1; linear; mRNA; EST; PLN; 303 BP.
EL625681;
EST3187 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137D121, mRNA sequence.

EL625682; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL625682;
EST3188 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137E021, mRNA sequence.

EL625683; SV 1; linear; mRNA; EST; PLN; 180 BP.
EL625683;
EST3189 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137E051, mRNA sequence.

EL625684; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL625684;
EST3190 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137F031, mRNA sequence.

EL625685; SV 1; linear; mRNA; EST; PLN; 668 BP.
EL625685;
EST3191 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137F121, mRNA sequence.

EL625686; SV 1; linear; mRNA; EST; PLN; 823 BP.
EL625686;
EST3192 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137G051, mRNA sequence.

EL625687; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL625687;
EST3193 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137G111, mRNA sequence.

EL625688; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL625688;
EST3194 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137H061, mRNA sequence.

EL625689; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL625689;
EST3195 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137H071, mRNA sequence.

EL625690; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL625690;
EST3196 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137H081, mRNA sequence.

EL625691; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL625691;
EST3197 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B137H111, mRNA sequence.

EL625692; SV 1; linear; mRNA; EST; PLN; 893 BP.
EL625692;
EST3198 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138A011, mRNA sequence.

EL625693; SV 1; linear; mRNA; EST; PLN; 942 BP.
EL625693;
EST3199 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138A021, mRNA sequence.

EL625694; SV 1; linear; mRNA; EST; PLN; 877 BP.
EL625694;
EST3200 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138A031, mRNA sequence.

EL625695; SV 1; linear; mRNA; EST; PLN; 867 BP.
EL625695;
EST3201 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138A071, mRNA sequence.

EL625696; SV 1; linear; mRNA; EST; PLN; 897 BP.
EL625696;
EST3202 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138B031, mRNA sequence.

EL625697; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL625697;
EST3203 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138C011, mRNA sequence.

EL625698; SV 1; linear; mRNA; EST; PLN; 952 BP.
EL625698;
EST3204 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138C091, mRNA sequence.

EL625699; SV 1; linear; mRNA; EST; PLN; 638 BP.
EL625699;
EST3205 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138C101, mRNA sequence.

EL625700; SV 1; linear; mRNA; EST; PLN; 628 BP.
EL625700;
EST3206 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138C121, mRNA sequence.

EL625701; SV 1; linear; mRNA; EST; PLN; 936 BP.
EL625701;
EST3207 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138D061, mRNA sequence.

EL625702; SV 1; linear; mRNA; EST; PLN; 830 BP.
EL625702;
EST3208 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138D101, mRNA sequence.

EL625703; SV 1; linear; mRNA; EST; PLN; 879 BP.
EL625703;
EST3209 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138D121, mRNA sequence.

EL625704; SV 1; linear; mRNA; EST; PLN; 891 BP.
EL625704;
EST3210 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138E031, mRNA sequence.

EL625705; SV 1; linear; mRNA; EST; PLN; 882 BP.
EL625705;
EST3211 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138E061, mRNA sequence.

EL625706; SV 1; linear; mRNA; EST; PLN; 859 BP.
EL625706;
EST3212 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138G021, mRNA sequence.

EL625707; SV 1; linear; mRNA; EST; PLN; 826 BP.
EL625707;
EST3213 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138H091, mRNA sequence.

EL625708; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL625708;
EST3214 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B138H111, mRNA sequence.

EL625709; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL625709;
EST3215 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139B071, mRNA sequence.

EL625710; SV 1; linear; mRNA; EST; PLN; 932 BP.
EL625710;
EST3216 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139C031, mRNA sequence.

EL625711; SV 1; linear; mRNA; EST; PLN; 795 BP.
EL625711;
EST3217 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139C051, mRNA sequence.

EL625712; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL625712;
EST3218 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139C111, mRNA sequence.

EL625713; SV 1; linear; mRNA; EST; PLN; 943 BP.
EL625713;
EST3219 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139D011, mRNA sequence.

EL625714; SV 1; linear; mRNA; EST; PLN; 884 BP.
EL625714;
EST3220 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139D021, mRNA sequence.

EL625715; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL625715;
EST3221 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139D051, mRNA sequence.

EL625716; SV 1; linear; mRNA; EST; PLN; 300 BP.
EL625716;
EST3222 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139E011, mRNA sequence.

EL625717; SV 1; linear; mRNA; EST; PLN; 498 BP.
EL625717;
EST3223 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139E051, mRNA sequence.

EL625718; SV 1; linear; mRNA; EST; PLN; 408 BP.
EL625718;
EST3224 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139E061, mRNA sequence.

EL625719; SV 1; linear; mRNA; EST; PLN; 360 BP.
EL625719;
EST3225 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139E081, mRNA sequence.

EL625720; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL625720;
EST3226 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139F011, mRNA sequence.

EL625721; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL625721;
EST3227 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139F111, mRNA sequence.

EL625722; SV 1; linear; mRNA; EST; PLN; 465 BP.
EL625722;
EST3228 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139F121, mRNA sequence.

EL625723; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL625723;
EST3229 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139G011, mRNA sequence.

EL625724; SV 1; linear; mRNA; EST; PLN; 450 BP.
EL625724;
EST3230 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139G061, mRNA sequence.

EL625725; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL625725;
EST3231 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139G071, mRNA sequence.

EL625726; SV 1; linear; mRNA; EST; PLN; 476 BP.
EL625726;
EST3232 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139G111, mRNA sequence.

EL625727; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL625727;
EST3233 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139H021, mRNA sequence.

EL625728; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL625728;
EST3234 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139H031, mRNA sequence.

EL625729; SV 1; linear; mRNA; EST; PLN; 448 BP.
EL625729;
EST3235 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139H051, mRNA sequence.

EL625730; SV 1; linear; mRNA; EST; PLN; 616 BP.
EL625730;
EST3236 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B139H061, mRNA sequence.

EL625731; SV 1; linear; mRNA; EST; PLN; 468 BP.
EL625731;
EST3237 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140A041, mRNA sequence.

EL625732; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL625732;
EST3238 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140B011, mRNA sequence.

EL625733; SV 1; linear; mRNA; EST; PLN; 617 BP.
EL625733;
EST3239 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140B021, mRNA sequence.

EL625734; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL625734;
EST3240 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140B031, mRNA sequence.

EL625735; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL625735;
EST3241 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140B061, mRNA sequence.

EL625736; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL625736;
EST3242 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140B071, mRNA sequence.

EL625737; SV 1; linear; mRNA; EST; PLN; 400 BP.
EL625737;
EST3243 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140B091, mRNA sequence.

EL625738; SV 1; linear; mRNA; EST; PLN; 517 BP.
EL625738;
EST3244 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140C051, mRNA sequence.

EL625739; SV 1; linear; mRNA; EST; PLN; 447 BP.
EL625739;
EST3245 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140C061, mRNA sequence.

EL625740; SV 1; linear; mRNA; EST; PLN; 460 BP.
EL625740;
EST3246 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140C121, mRNA sequence.

EL625741; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL625741;
EST3247 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140D051, mRNA sequence.

EL625742; SV 1; linear; mRNA; EST; PLN; 366 BP.
EL625742;
EST3248 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140D081, mRNA sequence.

EL625743; SV 1; linear; mRNA; EST; PLN; 300 BP.
EL625743;
EST3249 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140E041, mRNA sequence.

EL625744; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL625744;
EST3250 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140E061, mRNA sequence.

EL625745; SV 1; linear; mRNA; EST; PLN; 444 BP.
EL625745;
EST3251 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140E111, mRNA sequence.

EL625746; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL625746;
EST3252 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140F021, mRNA sequence.

EL625747; SV 1; linear; mRNA; EST; PLN; 842 BP.
EL625747;
EST3253 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140F111, mRNA sequence.

EL625748; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL625748;
EST3254 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140G041, mRNA sequence.

EL625749; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL625749;
EST3255 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140G101, mRNA sequence.

EL625750; SV 1; linear; mRNA; EST; PLN; 498 BP.
EL625750;
EST3256 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140H041, mRNA sequence.

EL625751; SV 1; linear; mRNA; EST; PLN; 387 BP.
EL625751;
EST3257 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140H061, mRNA sequence.

EL625752; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL625752;
EST3258 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B140H111, mRNA sequence.

EL625753; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL625753;
EST3259 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141A021, mRNA sequence.

EL625754; SV 1; linear; mRNA; EST; PLN; 399 BP.
EL625754;
EST3260 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141A031, mRNA sequence.

EL625755; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL625755;
EST3261 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141B091, mRNA sequence.

EL625756; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL625756;
EST3262 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141C021, mRNA sequence.

EL625757; SV 1; linear; mRNA; EST; PLN; 280 BP.
EL625757;
EST3263 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141C101, mRNA sequence.

EL625758; SV 1; linear; mRNA; EST; PLN; 623 BP.
EL625758;
EST3264 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141D021, mRNA sequence.

EL625759; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL625759;
EST3265 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141D041, mRNA sequence.

EL625760; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL625760;
EST3266 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141D051, mRNA sequence.

EL625761; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL625761;
EST3267 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141D061, mRNA sequence.

EL625762; SV 1; linear; mRNA; EST; PLN; 618 BP.
EL625762;
EST3268 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141D081, mRNA sequence.

EL625763; SV 1; linear; mRNA; EST; PLN; 495 BP.
EL625763;
EST3269 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141F031, mRNA sequence.

EL625764; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL625764;
EST3270 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141F051, mRNA sequence.

EL625765; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL625765;
EST3271 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141F091, mRNA sequence.

EL625766; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL625766;
EST3272 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141F121, mRNA sequence.

EL625767; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL625767;
EST3273 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141G021, mRNA sequence.

EL625768; SV 1; linear; mRNA; EST; PLN; 655 BP.
EL625768;
EST3274 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141G031, mRNA sequence.

EL625769; SV 1; linear; mRNA; EST; PLN; 392 BP.
EL625769;
EST3275 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141G041, mRNA sequence.

EL625770; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL625770;
EST3276 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141G051, mRNA sequence.

EL625771; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL625771;
EST3277 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141G101, mRNA sequence.

EL625772; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL625772;
EST3278 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141H011, mRNA sequence.

EL625773; SV 1; linear; mRNA; EST; PLN; 570 BP.
EL625773;
EST3279 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B141H041, mRNA sequence.

EL625774; SV 1; linear; mRNA; EST; PLN; 475 BP.
EL625774;
EST3280 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142A031, mRNA sequence.

EL625775; SV 1; linear; mRNA; EST; PLN; 385 BP.
EL625775;
EST3281 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142A111, mRNA sequence.

EL625776; SV 1; linear; mRNA; EST; PLN; 422 BP.
EL625776;
EST3282 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142B051, mRNA sequence.

EL625777; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL625777;
EST3283 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142B071, mRNA sequence.

EL625778; SV 1; linear; mRNA; EST; PLN; 462 BP.
EL625778;
EST3284 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142B081, mRNA sequence.

EL625779; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL625779;
EST3285 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142B121, mRNA sequence.

EL625780; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL625780;
EST3286 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142C011, mRNA sequence.

EL625781; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL625781;
EST3287 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142C021, mRNA sequence.

EL625782; SV 1; linear; mRNA; EST; PLN; 449 BP.
EL625782;
EST3288 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142C101, mRNA sequence.

EL625783; SV 1; linear; mRNA; EST; PLN; 466 BP.
EL625783;
EST3289 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142D011, mRNA sequence.

EL625784; SV 1; linear; mRNA; EST; PLN; 786 BP.
EL625784;
EST3290 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142D031, mRNA sequence.

EL625785; SV 1; linear; mRNA; EST; PLN; 623 BP.
EL625785;
EST3291 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142D071, mRNA sequence.

EL625786; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL625786;
EST3292 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142D111, mRNA sequence.

EL625787; SV 1; linear; mRNA; EST; PLN; 354 BP.
EL625787;
EST3293 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142E031, mRNA sequence.

EL625788; SV 1; linear; mRNA; EST; PLN; 473 BP.
EL625788;
EST3294 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142E051, mRNA sequence.

EL625789; SV 1; linear; mRNA; EST; PLN; 500 BP.
EL625789;
EST3295 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142F031, mRNA sequence.

EL625790; SV 1; linear; mRNA; EST; PLN; 460 BP.
EL625790;
EST3296 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142F051, mRNA sequence.

EL625791; SV 1; linear; mRNA; EST; PLN; 472 BP.
EL625791;
EST3297 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142F101, mRNA sequence.

EL625792; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL625792;
EST3298 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142G031, mRNA sequence.

EL625793; SV 1; linear; mRNA; EST; PLN; 887 BP.
EL625793;
EST3299 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142G071, mRNA sequence.

EL625794; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625794;
EST3300 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142G101, mRNA sequence.

EL625795; SV 1; linear; mRNA; EST; PLN; 857 BP.
EL625795;
EST3301 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B142H101, mRNA sequence.

EL625796; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL625796;
EST3302 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143A051, mRNA sequence.

EL625797; SV 1; linear; mRNA; EST; PLN; 598 BP.
EL625797;
EST3303 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143B031, mRNA sequence.

EL625798; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL625798;
EST3304 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143B071, mRNA sequence.

EL625799; SV 1; linear; mRNA; EST; PLN; 387 BP.
EL625799;
EST3305 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143B081, mRNA sequence.

EL625800; SV 1; linear; mRNA; EST; PLN; 750 BP.
EL625800;
EST3306 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143B111, mRNA sequence.

EL625801; SV 1; linear; mRNA; EST; PLN; 790 BP.
EL625801;
EST3307 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143C021, mRNA sequence.

EL625802; SV 1; linear; mRNA; EST; PLN; 801 BP.
EL625802;
EST3308 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143C071, mRNA sequence.

EL625803; SV 1; linear; mRNA; EST; PLN; 660 BP.
EL625803;
EST3309 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143D031, mRNA sequence.

EL625804; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL625804;
EST3310 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143E061, mRNA sequence.

EL625805; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL625805;
EST3311 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143E081, mRNA sequence.

EL625806; SV 1; linear; mRNA; EST; PLN; 268 BP.
EL625806;
EST3312 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143F031, mRNA sequence.

EL625807; SV 1; linear; mRNA; EST; PLN; 493 BP.
EL625807;
EST3313 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143F081, mRNA sequence.

EL625808; SV 1; linear; mRNA; EST; PLN; 486 BP.
EL625808;
EST3314 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143F101, mRNA sequence.

EL625809; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL625809;
EST3315 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143G091, mRNA sequence.

EL625810; SV 1; linear; mRNA; EST; PLN; 419 BP.
EL625810;
EST3316 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B143H051, mRNA sequence.

EL625811; SV 1; linear; mRNA; EST; PLN; 398 BP.
EL625811;
EST3317 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144A011, mRNA sequence.

EL625812; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL625812;
EST3318 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144A061, mRNA sequence.

EL625813; SV 1; linear; mRNA; EST; PLN; 855 BP.
EL625813;
EST3319 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144A121, mRNA sequence.

EL625814; SV 1; linear; mRNA; EST; PLN; 857 BP.
EL625814;
EST3320 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144B031, mRNA sequence.

EL625815; SV 1; linear; mRNA; EST; PLN; 580 BP.
EL625815;
EST3321 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144B051, mRNA sequence.

EL625816; SV 1; linear; mRNA; EST; PLN; 273 BP.
EL625816;
EST3322 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144C071, mRNA sequence.

EL625817; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL625817;
EST3323 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144D071, mRNA sequence.

EL625818; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL625818;
EST3324 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144D091, mRNA sequence.

EL625819; SV 1; linear; mRNA; EST; PLN; 361 BP.
EL625819;
EST3325 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144F021, mRNA sequence.

EL625820; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL625820;
EST3326 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144F041, mRNA sequence.

EL625821; SV 1; linear; mRNA; EST; PLN; 918 BP.
EL625821;
EST3327 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144F081, mRNA sequence.

EL625822; SV 1; linear; mRNA; EST; PLN; 422 BP.
EL625822;
EST3328 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144F091, mRNA sequence.

EL625823; SV 1; linear; mRNA; EST; PLN; 313 BP.
EL625823;
EST3329 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144G081, mRNA sequence.

EL625824; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL625824;
EST3330 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144G121, mRNA sequence.

EL625825; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL625825;
EST3331 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144H041, mRNA sequence.

EL625826; SV 1; linear; mRNA; EST; PLN; 426 BP.
EL625826;
EST3332 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B144H071, mRNA sequence.

EL625827; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL625827;
EST3333 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145A011, mRNA sequence.

EL625828; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL625828;
EST3334 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145A021, mRNA sequence.

EL625829; SV 1; linear; mRNA; EST; PLN; 564 BP.
EL625829;
EST3335 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145A061, mRNA sequence.

EL625830; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL625830;
EST3336 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145B011, mRNA sequence.

EL625831; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL625831;
EST3337 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145B111, mRNA sequence.

EL625832; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL625832;
EST3338 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145C011, mRNA sequence.

EL625833; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL625833;
EST3339 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145C061, mRNA sequence.

EL625834; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL625834;
EST3340 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145C101, mRNA sequence.

EL625835; SV 1; linear; mRNA; EST; PLN; 522 BP.
EL625835;
EST3341 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145D021, mRNA sequence.

EL625836; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL625836;
EST3342 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145D031, mRNA sequence.

EL625837; SV 1; linear; mRNA; EST; PLN; 732 BP.
EL625837;
EST3343 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145D101, mRNA sequence.

EL625838; SV 1; linear; mRNA; EST; PLN; 770 BP.
EL625838;
EST3344 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145D121, mRNA sequence.

EL625839; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL625839;
EST3345 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145F011, mRNA sequence.

EL625840; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL625840;
EST3346 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145F091, mRNA sequence.

EL625841; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL625841;
EST3347 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145F121, mRNA sequence.

EL625842; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL625842;
EST3348 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145G111, mRNA sequence.

EL625843; SV 1; linear; mRNA; EST; PLN; 682 BP.
EL625843;
EST3349 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B145G121, mRNA sequence.

EL625844; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL625844;
EST3350 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146A051, mRNA sequence.

EL625845; SV 1; linear; mRNA; EST; PLN; 762 BP.
EL625845;
EST3351 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146A091, mRNA sequence.

EL625846; SV 1; linear; mRNA; EST; PLN; 778 BP.
EL625846;
EST3352 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146B011, mRNA sequence.

EL625847; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL625847;
EST3353 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146B081, mRNA sequence.

EL625848; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL625848;
EST3354 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146B121, mRNA sequence.

EL625849; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL625849;
EST3355 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146C021, mRNA sequence.

EL625850; SV 1; linear; mRNA; EST; PLN; 754 BP.
EL625850;
EST3356 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146C041, mRNA sequence.

EL625851; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL625851;
EST3357 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146C101, mRNA sequence.

EL625852; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625852;
EST3358 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146D021, mRNA sequence.

EL625853; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL625853;
EST3359 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146D061, mRNA sequence.

EL625854; SV 1; linear; mRNA; EST; PLN; 833 BP.
EL625854;
EST3360 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146D071, mRNA sequence.

EL625855; SV 1; linear; mRNA; EST; PLN; 808 BP.
EL625855;
EST3361 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146D081, mRNA sequence.

EL625856; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL625856;
EST3362 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146D121, mRNA sequence.

EL625857; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL625857;
EST3363 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146E011, mRNA sequence.

EL625858; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL625858;
EST3364 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146F011, mRNA sequence.

EL625859; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL625859;
EST3365 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146F041, mRNA sequence.

EL625860; SV 1; linear; mRNA; EST; PLN; 630 BP.
EL625860;
EST3366 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146F071, mRNA sequence.

EL625861; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL625861;
EST3367 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146G031, mRNA sequence.

EL625862; SV 1; linear; mRNA; EST; PLN; 654 BP.
EL625862;
EST3368 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146G041, mRNA sequence.

EL625863; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625863;
EST3369 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146G071, mRNA sequence.

EL625864; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625864;
EST3370 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146H011, mRNA sequence.

EL625865; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL625865;
EST3371 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146H051, mRNA sequence.

EL625866; SV 1; linear; mRNA; EST; PLN; 708 BP.
EL625866;
EST3372 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B146H081, mRNA sequence.

EL625867; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625867;
EST3373 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147A041, mRNA sequence.

EL625868; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL625868;
EST3374 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147A071, mRNA sequence.

EL625869; SV 1; linear; mRNA; EST; PLN; 643 BP.
EL625869;
EST3375 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147A111, mRNA sequence.

EL625870; SV 1; linear; mRNA; EST; PLN; 675 BP.
EL625870;
EST3376 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147A121, mRNA sequence.

EL625871; SV 1; linear; mRNA; EST; PLN; 708 BP.
EL625871;
EST3377 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147B061, mRNA sequence.

EL625872; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL625872;
EST3378 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147B121, mRNA sequence.

EL625873; SV 1; linear; mRNA; EST; PLN; 709 BP.
EL625873;
EST3379 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147C011, mRNA sequence.

EL625874; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL625874;
EST3380 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147C031, mRNA sequence.

EL625875; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL625875;
EST3381 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147C061, mRNA sequence.

EL625876; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL625876;
EST3382 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147D091, mRNA sequence.

EL625877; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL625877;
EST3383 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147D101, mRNA sequence.

EL625878; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL625878;
EST3384 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147E061, mRNA sequence.

EL625879; SV 1; linear; mRNA; EST; PLN; 402 BP.
EL625879;
EST3385 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147E081, mRNA sequence.

EL625880; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL625880;
EST3386 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147F051, mRNA sequence.

EL625881; SV 1; linear; mRNA; EST; PLN; 577 BP.
EL625881;
EST3387 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147G041, mRNA sequence.

EL625882; SV 1; linear; mRNA; EST; PLN; 706 BP.
EL625882;
EST3388 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147G081, mRNA sequence.

EL625883; SV 1; linear; mRNA; EST; PLN; 366 BP.
EL625883;
EST3389 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147H021, mRNA sequence.

EL625884; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625884;
EST3390 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B147H101, mRNA sequence.

EL625885; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL625885;
EST3391 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148A041, mRNA sequence.

EL625886; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL625886;
EST3392 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148A061, mRNA sequence.

EL625887; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL625887;
EST3393 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148A091, mRNA sequence.

EL625888; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL625888;
EST3394 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148D011, mRNA sequence.

EL625889; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL625889;
EST3395 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148E011, mRNA sequence.

EL625890; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL625890;
EST3396 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148E021, mRNA sequence.

EL625891; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL625891;
EST3397 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148E111, mRNA sequence.

EL625892; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL625892;
EST3398 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148F011, mRNA sequence.

EL625893; SV 1; linear; mRNA; EST; PLN; 595 BP.
EL625893;
EST3399 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148F021, mRNA sequence.

EL625894; SV 1; linear; mRNA; EST; PLN; 682 BP.
EL625894;
EST3400 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148F061, mRNA sequence.

EL625895; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL625895;
EST3401 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148F121, mRNA sequence.

EL625896; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL625896;
EST3402 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148G031, mRNA sequence.

EL625897; SV 1; linear; mRNA; EST; PLN; 642 BP.
EL625897;
EST3403 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148G081, mRNA sequence.

EL625898; SV 1; linear; mRNA; EST; PLN; 664 BP.
EL625898;
EST3404 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148G111, mRNA sequence.

EL625899; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL625899;
EST3405 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B148H091, mRNA sequence.

EL625900; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625900;
EST3406 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149A051, mRNA sequence.

EL625901; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625901;
EST3407 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149A081, mRNA sequence.

EL625902; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL625902;
EST3408 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149A111, mRNA sequence.

EL625903; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625903;
EST3409 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149B051, mRNA sequence.

EL625904; SV 1; linear; mRNA; EST; PLN; 514 BP.
EL625904;
EST3410 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149C021, mRNA sequence.

EL625905; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL625905;
EST3411 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149C051, mRNA sequence.

EL625906; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL625906;
EST3412 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149C101, mRNA sequence.

EL625907; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL625907;
EST3413 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149C121, mRNA sequence.

EL625908; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL625908;
EST3414 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149D041, mRNA sequence.

EL625909; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL625909;
EST3415 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149E061, mRNA sequence.

EL625910; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL625910;
EST3416 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149E091, mRNA sequence.

EL625911; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625911;
EST3417 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149F051, mRNA sequence.

EL625912; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL625912;
EST3418 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149F101, mRNA sequence.

EL625913; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL625913;
EST3419 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149G041, mRNA sequence.

EL625914; SV 1; linear; mRNA; EST; PLN; 710 BP.
EL625914;
EST3420 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149H041, mRNA sequence.

EL625915; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL625915;
EST3421 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149H081, mRNA sequence.

EL625916; SV 1; linear; mRNA; EST; PLN; 709 BP.
EL625916;
EST3422 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149H091, mRNA sequence.

EL625917; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL625917;
EST3423 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B149H111, mRNA sequence.

EL625918; SV 1; linear; mRNA; EST; PLN; 583 BP.
EL625918;
EST3424 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150A091, mRNA sequence.

EL625919; SV 1; linear; mRNA; EST; PLN; 683 BP.
EL625919;
EST3425 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150A121, mRNA sequence.

EL625920; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL625920;
EST3426 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150B021, mRNA sequence.

EL625921; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL625921;
EST3427 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150B041, mRNA sequence.

EL625922; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL625922;
EST3428 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150B111, mRNA sequence.

EL625923; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL625923;
EST3429 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150C071, mRNA sequence.

EL625924; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625924;
EST3430 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150D021, mRNA sequence.

EL625925; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL625925;
EST3431 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150E011, mRNA sequence.

EL625926; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL625926;
EST3432 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150F011, mRNA sequence.

EL625927; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL625927;
EST3433 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150F041, mRNA sequence.

EL625928; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL625928;
EST3434 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150F071, mRNA sequence.

EL625929; SV 1; linear; mRNA; EST; PLN; 671 BP.
EL625929;
EST3435 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150F121, mRNA sequence.

EL625930; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL625930;
EST3436 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150G011, mRNA sequence.

EL625931; SV 1; linear; mRNA; EST; PLN; 377 BP.
EL625931;
EST3437 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150G031, mRNA sequence.

EL625932; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL625932;
EST3438 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B150G101, mRNA sequence.

EL625933; SV 1; linear; mRNA; EST; PLN; 698 BP.
EL625933;
EST3439 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151B041, mRNA sequence.

EL625934; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL625934;
EST3440 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151B111, mRNA sequence.

EL625935; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL625935;
EST3441 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151C071, mRNA sequence.

EL625936; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625936;
EST3442 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151D051, mRNA sequence.

EL625937; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625937;
EST3443 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151D111, mRNA sequence.

EL625938; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625938;
EST3444 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151E011, mRNA sequence.

EL625939; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL625939;
EST3445 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151F011, mRNA sequence.

EL625940; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL625940;
EST3446 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151F031, mRNA sequence.

EL625941; SV 1; linear; mRNA; EST; PLN; 688 BP.
EL625941;
EST3447 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151H021, mRNA sequence.

EL625942; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL625942;
EST3448 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B151H051, mRNA sequence.

EL625943; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL625943;
EST3449 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152A031, mRNA sequence.

EL625944; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625944;
EST3450 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152A041, mRNA sequence.

EL625945; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL625945;
EST3451 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152B031, mRNA sequence.

EL625946; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL625946;
EST3452 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152B041, mRNA sequence.

EL625947; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL625947;
EST3453 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152B081, mRNA sequence.

EL625948; SV 1; linear; mRNA; EST; PLN; 391 BP.
EL625948;
EST3454 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152B121, mRNA sequence.

EL625949; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625949;
EST3455 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152D031, mRNA sequence.

EL625950; SV 1; linear; mRNA; EST; PLN; 474 BP.
EL625950;
EST3456 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152E011, mRNA sequence.

EL625951; SV 1; linear; mRNA; EST; PLN; 702 BP.
EL625951;
EST3457 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152E071, mRNA sequence.

EL625952; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL625952;
EST3458 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152E101, mRNA sequence.

EL625953; SV 1; linear; mRNA; EST; PLN; 681 BP.
EL625953;
EST3459 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152F041, mRNA sequence.

EL625954; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL625954;
EST3460 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152F111, mRNA sequence.

EL625955; SV 1; linear; mRNA; EST; PLN; 687 BP.
EL625955;
EST3461 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152G051, mRNA sequence.

EL625956; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL625956;
EST3462 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152G111, mRNA sequence.

EL625957; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL625957;
EST3463 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152G121, mRNA sequence.

EL625958; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL625958;
EST3464 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152H031, mRNA sequence.

EL625959; SV 1; linear; mRNA; EST; PLN; 693 BP.
EL625959;
EST3465 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152H071, mRNA sequence.

EL625960; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625960;
EST3466 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152H111, mRNA sequence.

EL625961; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL625961;
EST3467 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B152H121, mRNA sequence.

EL625962; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL625962;
EST3468 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153A041, mRNA sequence.

EL625963; SV 1; linear; mRNA; EST; PLN; 674 BP.
EL625963;
EST3469 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153A071, mRNA sequence.

EL625964; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL625964;
EST3470 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153C021, mRNA sequence.

EL625965; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625965;
EST3471 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153C051, mRNA sequence.

EL625966; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625966;
EST3472 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153D051, mRNA sequence.

EL625967; SV 1; linear; mRNA; EST; PLN; 691 BP.
EL625967;
EST3473 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153D091, mRNA sequence.

EL625968; SV 1; linear; mRNA; EST; PLN; 695 BP.
EL625968;
EST3474 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153D111, mRNA sequence.

EL625969; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL625969;
EST3475 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153E011, mRNA sequence.

EL625970; SV 1; linear; mRNA; EST; PLN; 687 BP.
EL625970;
EST3476 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153E051, mRNA sequence.

EL625971; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL625971;
EST3477 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153E061, mRNA sequence.

EL625972; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625972;
EST3478 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153E071, mRNA sequence.

EL625973; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL625973;
EST3479 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153E091, mRNA sequence.

EL625974; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL625974;
EST3480 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153E101, mRNA sequence.

EL625975; SV 1; linear; mRNA; EST; PLN; 687 BP.
EL625975;
EST3481 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153F021, mRNA sequence.

EL625976; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL625976;
EST3482 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153F051, mRNA sequence.

EL625977; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL625977;
EST3483 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153F091, mRNA sequence.

EL625978; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL625978;
EST3484 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153G011, mRNA sequence.

EL625979; SV 1; linear; mRNA; EST; PLN; 503 BP.
EL625979;
EST3485 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153G091, mRNA sequence.

EL625980; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL625980;
EST3486 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153H051, mRNA sequence.

EL625981; SV 1; linear; mRNA; EST; PLN; 619 BP.
EL625981;
EST3487 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B153H071, mRNA sequence.

EL625982; SV 1; linear; mRNA; EST; PLN; 254 BP.
EL625982;
EST3488 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154A031, mRNA sequence.

EL625983; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL625983;
EST3489 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154A091, mRNA sequence.

EL625984; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL625984;
EST3490 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154A121, mRNA sequence.

EL625985; SV 1; linear; mRNA; EST; PLN; 659 BP.
EL625985;
EST3491 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154B021, mRNA sequence.

EL625986; SV 1; linear; mRNA; EST; PLN; 832 BP.
EL625986;
EST3492 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154B041, mRNA sequence.

EL625987; SV 1; linear; mRNA; EST; PLN; 714 BP.
EL625987;
EST3493 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154B081, mRNA sequence.

EL625988; SV 1; linear; mRNA; EST; PLN; 704 BP.
EL625988;
EST3494 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154C081, mRNA sequence.

EL625989; SV 1; linear; mRNA; EST; PLN; 856 BP.
EL625989;
EST3495 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154C091, mRNA sequence.

EL625990; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL625990;
EST3496 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154D051, mRNA sequence.

EL625991; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL625991;
EST3497 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154E041, mRNA sequence.

EL625992; SV 1; linear; mRNA; EST; PLN; 638 BP.
EL625992;
EST3498 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154E051, mRNA sequence.

EL625993; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL625993;
EST3499 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154E071, mRNA sequence.

EL625994; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL625994;
EST3500 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154E101, mRNA sequence.

EL625995; SV 1; linear; mRNA; EST; PLN; 699 BP.
EL625995;
EST3501 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154F041, mRNA sequence.

EL625996; SV 1; linear; mRNA; EST; PLN; 712 BP.
EL625996;
EST3502 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154F061, mRNA sequence.

EL625997; SV 1; linear; mRNA; EST; PLN; 718 BP.
EL625997;
EST3503 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154F071, mRNA sequence.

EL625998; SV 1; linear; mRNA; EST; PLN; 660 BP.
EL625998;
EST3504 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154F101, mRNA sequence.

EL625999; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL625999;
EST3505 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154F111, mRNA sequence.

EL626000; SV 1; linear; mRNA; EST; PLN; 728 BP.
EL626000;
EST3506 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154G011, mRNA sequence.

EL626001; SV 1; linear; mRNA; EST; PLN; 783 BP.
EL626001;
EST3507 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154G121, mRNA sequence.

EL626002; SV 1; linear; mRNA; EST; PLN; 621 BP.
EL626002;
EST3508 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154H021, mRNA sequence.

EL626003; SV 1; linear; mRNA; EST; PLN; 728 BP.
EL626003;
EST3509 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B154H031, mRNA sequence.

EL626004; SV 1; linear; mRNA; EST; PLN; 740 BP.
EL626004;
EST3510 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155A091, mRNA sequence.

EL626005; SV 1; linear; mRNA; EST; PLN; 682 BP.
EL626005;
EST3511 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155A111, mRNA sequence.

EL626006; SV 1; linear; mRNA; EST; PLN; 781 BP.
EL626006;
EST3512 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155B051, mRNA sequence.

EL626007; SV 1; linear; mRNA; EST; PLN; 421 BP.
EL626007;
EST3513 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155B061, mRNA sequence.

EL626008; SV 1; linear; mRNA; EST; PLN; 677 BP.
EL626008;
EST3514 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155C041, mRNA sequence.

EL626009; SV 1; linear; mRNA; EST; PLN; 725 BP.
EL626009;
EST3515 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155D111, mRNA sequence.

EL626010; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL626010;
EST3516 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155E021, mRNA sequence.

EL626011; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL626011;
EST3517 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155E081, mRNA sequence.

EL626012; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL626012;
EST3518 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155E111, mRNA sequence.

EL626013; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL626013;
EST3519 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155E121, mRNA sequence.

EL626014; SV 1; linear; mRNA; EST; PLN; 686 BP.
EL626014;
EST3520 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155G041, mRNA sequence.

EL626015; SV 1; linear; mRNA; EST; PLN; 613 BP.
EL626015;
EST3521 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155H031, mRNA sequence.

EL626016; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL626016;
EST3522 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155H051, mRNA sequence.

EL626017; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL626017;
EST3523 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B155H111, mRNA sequence.

EL626018; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL626018;
EST3524 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156A031, mRNA sequence.

EL626019; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL626019;
EST3525 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156B051, mRNA sequence.

EL626020; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL626020;
EST3526 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156B091, mRNA sequence.

EL626021; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL626021;
EST3527 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156C071, mRNA sequence.

EL626022; SV 1; linear; mRNA; EST; PLN; 579 BP.
EL626022;
EST3528 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156C091, mRNA sequence.

EL626023; SV 1; linear; mRNA; EST; PLN; 506 BP.
EL626023;
EST3529 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156C111, mRNA sequence.

EL626024; SV 1; linear; mRNA; EST; PLN; 540 BP.
EL626024;
EST3530 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156C121, mRNA sequence.

EL626025; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL626025;
EST3531 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156D021, mRNA sequence.

EL626026; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL626026;
EST3532 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156D061, mRNA sequence.

EL626027; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL626027;
EST3533 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156E051, mRNA sequence.

EL626028; SV 1; linear; mRNA; EST; PLN; 732 BP.
EL626028;
EST3534 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156F011, mRNA sequence.

EL626029; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL626029;
EST3535 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B156H121, mRNA sequence.

EL626030; SV 1; linear; mRNA; EST; PLN; 771 BP.
EL626030;
EST3536 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157A021, mRNA sequence.

EL626031; SV 1; linear; mRNA; EST; PLN; 808 BP.
EL626031;
EST3537 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157B051, mRNA sequence.

EL626032; SV 1; linear; mRNA; EST; PLN; 831 BP.
EL626032;
EST3538 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157B111, mRNA sequence.

EL626033; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL626033;
EST3539 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157C021, mRNA sequence.

EL626034; SV 1; linear; mRNA; EST; PLN; 212 BP.
EL626034;
EST3540 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157C061, mRNA sequence.

EL626035; SV 1; linear; mRNA; EST; PLN; 897 BP.
EL626035;
EST3541 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157C091, mRNA sequence.

EL626036; SV 1; linear; mRNA; EST; PLN; 724 BP.
EL626036;
EST3542 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157C111, mRNA sequence.

EL626037; SV 1; linear; mRNA; EST; PLN; 864 BP.
EL626037;
EST3543 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157E031, mRNA sequence.

EL626038; SV 1; linear; mRNA; EST; PLN; 852 BP.
EL626038;
EST3544 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157E101, mRNA sequence.

EL626039; SV 1; linear; mRNA; EST; PLN; 736 BP.
EL626039;
EST3545 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157G011, mRNA sequence.

EL626040; SV 1; linear; mRNA; EST; PLN; 928 BP.
EL626040;
EST3546 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157G061, mRNA sequence.

EL626041; SV 1; linear; mRNA; EST; PLN; 899 BP.
EL626041;
EST3547 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157G091, mRNA sequence.

EL626042; SV 1; linear; mRNA; EST; PLN; 792 BP.
EL626042;
EST3548 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157H031, mRNA sequence.

EL626043; SV 1; linear; mRNA; EST; PLN; 587 BP.
EL626043;
EST3549 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B157H081, mRNA sequence.

EL626044; SV 1; linear; mRNA; EST; PLN; 908 BP.
EL626044;
EST3550 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158A021, mRNA sequence.

EL626045; SV 1; linear; mRNA; EST; PLN; 909 BP.
EL626045;
EST3551 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158A121, mRNA sequence.

EL626046; SV 1; linear; mRNA; EST; PLN; 844 BP.
EL626046;
EST3552 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158D041, mRNA sequence.

EL626047; SV 1; linear; mRNA; EST; PLN; 446 BP.
EL626047;
EST3553 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158D081, mRNA sequence.

EL626048; SV 1; linear; mRNA; EST; PLN; 387 BP.
EL626048;
EST3554 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158D111, mRNA sequence.

EL626049; SV 1; linear; mRNA; EST; PLN; 476 BP.
EL626049;
EST3555 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158F031, mRNA sequence.

EL626050; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL626050;
EST3556 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158F071, mRNA sequence.

EL626051; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL626051;
EST3557 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158F091, mRNA sequence.

EL626052; SV 1; linear; mRNA; EST; PLN; 403 BP.
EL626052;
EST3558 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158F101, mRNA sequence.

EL626053; SV 1; linear; mRNA; EST; PLN; 397 BP.
EL626053;
EST3559 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B158G021, mRNA sequence.

EL626054; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL626054;
EST3560 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159A011, mRNA sequence.

EL626055; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL626055;
EST3561 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159A051, mRNA sequence.

EL626056; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL626056;
EST3562 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159A111, mRNA sequence.

EL626057; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL626057;
EST3563 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159B071, mRNA sequence.

EL626058; SV 1; linear; mRNA; EST; PLN; 575 BP.
EL626058;
EST3564 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159C021, mRNA sequence.

EL626059; SV 1; linear; mRNA; EST; PLN; 513 BP.
EL626059;
EST3565 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159C081, mRNA sequence.

EL626060; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL626060;
EST3566 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159E051, mRNA sequence.

EL626061; SV 1; linear; mRNA; EST; PLN; 453 BP.
EL626061;
EST3567 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159E091, mRNA sequence.

EL626062; SV 1; linear; mRNA; EST; PLN; 524 BP.
EL626062;
EST3568 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159F051, mRNA sequence.

EL626063; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL626063;
EST3569 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159F061, mRNA sequence.

EL626064; SV 1; linear; mRNA; EST; PLN; 492 BP.
EL626064;
EST3570 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159G061, mRNA sequence.

EL626065; SV 1; linear; mRNA; EST; PLN; 456 BP.
EL626065;
EST3571 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159H011, mRNA sequence.

EL626066; SV 1; linear; mRNA; EST; PLN; 519 BP.
EL626066;
EST3572 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B159H101, mRNA sequence.

EL626067; SV 1; linear; mRNA; EST; PLN; 731 BP.
EL626067;
EST3573 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160B021, mRNA sequence.

EL626068; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL626068;
EST3574 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160B031, mRNA sequence.

EL626069; SV 1; linear; mRNA; EST; PLN; 770 BP.
EL626069;
EST3575 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160B071, mRNA sequence.

EL626070; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL626070;
EST3576 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160B111, mRNA sequence.

EL626071; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL626071;
EST3577 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160D011, mRNA sequence.

EL626072; SV 1; linear; mRNA; EST; PLN; 829 BP.
EL626072;
EST3578 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160D071, mRNA sequence.

EL626073; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL626073;
EST3579 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160D121, mRNA sequence.

EL626074; SV 1; linear; mRNA; EST; PLN; 677 BP.
EL626074;
EST3580 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160F061, mRNA sequence.

EL626075; SV 1; linear; mRNA; EST; PLN; 730 BP.
EL626075;
EST3581 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160F081, mRNA sequence.

EL626076; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL626076;
EST3582 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160F111, mRNA sequence.

EL626077; SV 1; linear; mRNA; EST; PLN; 755 BP.
EL626077;
EST3583 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160H071, mRNA sequence.

EL626078; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL626078;
EST3584 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B160H101, mRNA sequence.

EL626079; SV 1; linear; mRNA; EST; PLN; 414 BP.
EL626079;
EST3585 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161A031, mRNA sequence.

EL626080; SV 1; linear; mRNA; EST; PLN; 811 BP.
EL626080;
EST3586 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161A061, mRNA sequence.

EL626081; SV 1; linear; mRNA; EST; PLN; 850 BP.
EL626081;
EST3587 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161A081, mRNA sequence.

EL626082; SV 1; linear; mRNA; EST; PLN; 820 BP.
EL626082;
EST3588 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161A111, mRNA sequence.

EL626083; SV 1; linear; mRNA; EST; PLN; 808 BP.
EL626083;
EST3589 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161B011, mRNA sequence.

EL626084; SV 1; linear; mRNA; EST; PLN; 810 BP.
EL626084;
EST3590 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161B031, mRNA sequence.

EL626085; SV 1; linear; mRNA; EST; PLN; 679 BP.
EL626085;
EST3591 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161B041, mRNA sequence.

EL626086; SV 1; linear; mRNA; EST; PLN; 855 BP.
EL626086;
EST3592 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161B061, mRNA sequence.

EL626087; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL626087;
EST3593 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161B071, mRNA sequence.

EL626088; SV 1; linear; mRNA; EST; PLN; 916 BP.
EL626088;
EST3594 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161B101, mRNA sequence.

EL626089; SV 1; linear; mRNA; EST; PLN; 823 BP.
EL626089;
EST3595 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161C021, mRNA sequence.

EL626090; SV 1; linear; mRNA; EST; PLN; 861 BP.
EL626090;
EST3596 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161C041, mRNA sequence.

EL626091; SV 1; linear; mRNA; EST; PLN; 792 BP.
EL626091;
EST3597 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161C101, mRNA sequence.

EL626092; SV 1; linear; mRNA; EST; PLN; 843 BP.
EL626092;
EST3598 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161C121, mRNA sequence.

EL626093; SV 1; linear; mRNA; EST; PLN; 674 BP.
EL626093;
EST3599 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161D051, mRNA sequence.

EL626094; SV 1; linear; mRNA; EST; PLN; 782 BP.
EL626094;
EST3600 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161E051, mRNA sequence.

EL626095; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL626095;
EST3601 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161E121, mRNA sequence.

EL626096; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL626096;
EST3602 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161G021, mRNA sequence.

EL626097; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL626097;
EST3603 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B161G051, mRNA sequence.

EL626098; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL626098;
EST3604 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162A011, mRNA sequence.

EL626099; SV 1; linear; mRNA; EST; PLN; 785 BP.
EL626099;
EST3605 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162A021, mRNA sequence.

EL626100; SV 1; linear; mRNA; EST; PLN; 271 BP.
EL626100;
EST3606 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162A051, mRNA sequence.

EL626101; SV 1; linear; mRNA; EST; PLN; 440 BP.
EL626101;
EST3607 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162B011, mRNA sequence.

EL626102; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL626102;
EST3608 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162C041, mRNA sequence.

EL626103; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL626103;
EST3609 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162C051, mRNA sequence.

EL626104; SV 1; linear; mRNA; EST; PLN; 577 BP.
EL626104;
EST3610 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162C061, mRNA sequence.

EL626105; SV 1; linear; mRNA; EST; PLN; 594 BP.
EL626105;
EST3611 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162C071, mRNA sequence.

EL626106; SV 1; linear; mRNA; EST; PLN; 428 BP.
EL626106;
EST3612 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162C081, mRNA sequence.

EL626107; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL626107;
EST3613 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162D051, mRNA sequence.

EL626108; SV 1; linear; mRNA; EST; PLN; 563 BP.
EL626108;
EST3614 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162E031, mRNA sequence.

EL626109; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL626109;
EST3615 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162E081, mRNA sequence.

EL626110; SV 1; linear; mRNA; EST; PLN; 649 BP.
EL626110;
EST3616 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162E121, mRNA sequence.

EL626111; SV 1; linear; mRNA; EST; PLN; 605 BP.
EL626111;
EST3617 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162F081, mRNA sequence.

EL626112; SV 1; linear; mRNA; EST; PLN; 428 BP.
EL626112;
EST3618 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162F121, mRNA sequence.

EL626113; SV 1; linear; mRNA; EST; PLN; 746 BP.
EL626113;
EST3619 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162H051, mRNA sequence.

EL626114; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL626114;
EST3620 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B162H111, mRNA sequence.

EL626115; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL626115;
EST3621 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163A061, mRNA sequence.

EL626116; SV 1; linear; mRNA; EST; PLN; 782 BP.
EL626116;
EST3622 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163B021, mRNA sequence.

EL626117; SV 1; linear; mRNA; EST; PLN; 766 BP.
EL626117;
EST3623 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163B051, mRNA sequence.

EL626118; SV 1; linear; mRNA; EST; PLN; 712 BP.
EL626118;
EST3624 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163B071, mRNA sequence.

EL626119; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL626119;
EST3625 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163C031, mRNA sequence.

EL626120; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL626120;
EST3626 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163E031, mRNA sequence.

EL626121; SV 1; linear; mRNA; EST; PLN; 721 BP.
EL626121;
EST3627 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163E121, mRNA sequence.

EL626122; SV 1; linear; mRNA; EST; PLN; 601 BP.
EL626122;
EST3628 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163F011, mRNA sequence.

EL626123; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL626123;
EST3629 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163F021, mRNA sequence.

EL626124; SV 1; linear; mRNA; EST; PLN; 740 BP.
EL626124;
EST3630 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163F121, mRNA sequence.

EL626125; SV 1; linear; mRNA; EST; PLN; 371 BP.
EL626125;
EST3631 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163G041, mRNA sequence.

EL626126; SV 1; linear; mRNA; EST; PLN; 416 BP.
EL626126;
EST3632 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163G091, mRNA sequence.

EL626127; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL626127;
EST3633 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163H111, mRNA sequence.

EL626128; SV 1; linear; mRNA; EST; PLN; 775 BP.
EL626128;
EST3634 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B163H121, mRNA sequence.

EL626129; SV 1; linear; mRNA; EST; PLN; 728 BP.
EL626129;
EST3635 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164A121, mRNA sequence.

EL626130; SV 1; linear; mRNA; EST; PLN; 689 BP.
EL626130;
EST3636 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164C081, mRNA sequence.

EL626131; SV 1; linear; mRNA; EST; PLN; 316 BP.
EL626131;
EST3637 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164C091, mRNA sequence.

EL626132; SV 1; linear; mRNA; EST; PLN; 428 BP.
EL626132;
EST3638 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164C111, mRNA sequence.

EL626133; SV 1; linear; mRNA; EST; PLN; 751 BP.
EL626133;
EST3639 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164E041, mRNA sequence.

EL626134; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL626134;
EST3640 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164F031, mRNA sequence.

EL626135; SV 1; linear; mRNA; EST; PLN; 469 BP.
EL626135;
EST3641 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164F061, mRNA sequence.

EL626136; SV 1; linear; mRNA; EST; PLN; 484 BP.
EL626136;
EST3642 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164F091, mRNA sequence.

EL626137; SV 1; linear; mRNA; EST; PLN; 534 BP.
EL626137;
EST3643 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164G011, mRNA sequence.

EL626138; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL626138;
EST3644 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164G071, mRNA sequence.

EL626139; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL626139;
EST3645 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164G101, mRNA sequence.

EL626140; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL626140;
EST3646 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164H071, mRNA sequence.

EL626141; SV 1; linear; mRNA; EST; PLN; 273 BP.
EL626141;
EST3647 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B164H081, mRNA sequence.

EL626142; SV 1; linear; mRNA; EST; PLN; 476 BP.
EL626142;
EST3648 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165A111, mRNA sequence.

EL626143; SV 1; linear; mRNA; EST; PLN; 435 BP.
EL626143;
EST3649 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165B021, mRNA sequence.

EL626144; SV 1; linear; mRNA; EST; PLN; 401 BP.
EL626144;
EST3650 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165B081, mRNA sequence.

EL626145; SV 1; linear; mRNA; EST; PLN; 632 BP.
EL626145;
EST3651 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165B111, mRNA sequence.

EL626146; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL626146;
EST3652 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165C011, mRNA sequence.

EL626147; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL626147;
EST3653 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165D011, mRNA sequence.

EL626148; SV 1; linear; mRNA; EST; PLN; 502 BP.
EL626148;
EST3654 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165E021, mRNA sequence.

EL626149; SV 1; linear; mRNA; EST; PLN; 640 BP.
EL626149;
EST3655 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165F101, mRNA sequence.

EL626150; SV 1; linear; mRNA; EST; PLN; 621 BP.
EL626150;
EST3656 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165G021, mRNA sequence.

EL626151; SV 1; linear; mRNA; EST; PLN; 622 BP.
EL626151;
EST3657 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165G091, mRNA sequence.

EL626152; SV 1; linear; mRNA; EST; PLN; 447 BP.
EL626152;
EST3658 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165G101, mRNA sequence.

EL626153; SV 1; linear; mRNA; EST; PLN; 517 BP.
EL626153;
EST3659 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165H071, mRNA sequence.

EL626154; SV 1; linear; mRNA; EST; PLN; 413 BP.
EL626154;
EST3660 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B165H091, mRNA sequence.

EL626155; SV 1; linear; mRNA; EST; PLN; 661 BP.
EL626155;
EST3661 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166A081, mRNA sequence.

EL626156; SV 1; linear; mRNA; EST; PLN; 619 BP.
EL626156;
EST3662 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166B011, mRNA sequence.

EL626157; SV 1; linear; mRNA; EST; PLN; 413 BP.
EL626157;
EST3663 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166B071, mRNA sequence.

EL626158; SV 1; linear; mRNA; EST; PLN; 444 BP.
EL626158;
EST3664 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166B081, mRNA sequence.

EL626159; SV 1; linear; mRNA; EST; PLN; 494 BP.
EL626159;
EST3665 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166B101, mRNA sequence.

EL626160; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL626160;
EST3666 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166C071, mRNA sequence.

EL626161; SV 1; linear; mRNA; EST; PLN; 595 BP.
EL626161;
EST3667 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166D011, mRNA sequence.

EL626162; SV 1; linear; mRNA; EST; PLN; 665 BP.
EL626162;
EST3668 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166D101, mRNA sequence.

EL626163; SV 1; linear; mRNA; EST; PLN; 297 BP.
EL626163;
EST3669 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166E051, mRNA sequence.

EL626164; SV 1; linear; mRNA; EST; PLN; 412 BP.
EL626164;
EST3670 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166E091, mRNA sequence.

EL626165; SV 1; linear; mRNA; EST; PLN; 391 BP.
EL626165;
EST3671 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166F011, mRNA sequence.

EL626166; SV 1; linear; mRNA; EST; PLN; 502 BP.
EL626166;
EST3672 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166F091, mRNA sequence.

EL626167; SV 1; linear; mRNA; EST; PLN; 596 BP.
EL626167;
EST3673 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166G041, mRNA sequence.

EL626168; SV 1; linear; mRNA; EST; PLN; 828 BP.
EL626168;
EST3674 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166G111, mRNA sequence.

EL626169; SV 1; linear; mRNA; EST; PLN; 415 BP.
EL626169;
EST3675 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166H041, mRNA sequence.

EL626170; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL626170;
EST3676 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B166H061, mRNA sequence.

EL626171; SV 1; linear; mRNA; EST; PLN; 470 BP.
EL626171;
EST3677 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167A091, mRNA sequence.

EL626172; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL626172;
EST3678 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167B081, mRNA sequence.

EL626173; SV 1; linear; mRNA; EST; PLN; 497 BP.
EL626173;
EST3679 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167D071, mRNA sequence.

EL626174; SV 1; linear; mRNA; EST; PLN; 585 BP.
EL626174;
EST3680 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167D081, mRNA sequence.

EL626175; SV 1; linear; mRNA; EST; PLN; 553 BP.
EL626175;
EST3681 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167D091, mRNA sequence.

EL626176; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL626176;
EST3682 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167E041, mRNA sequence.

EL626177; SV 1; linear; mRNA; EST; PLN; 573 BP.
EL626177;
EST3683 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167E091, mRNA sequence.

EL626178; SV 1; linear; mRNA; EST; PLN; 492 BP.
EL626178;
EST3684 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167F011, mRNA sequence.

EL626179; SV 1; linear; mRNA; EST; PLN; 308 BP.
EL626179;
EST3685 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167F051, mRNA sequence.

EL626180; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL626180;
EST3686 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167F071, mRNA sequence.

EL626181; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL626181;
EST3687 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167G041, mRNA sequence.

EL626182; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL626182;
EST3688 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167G051, mRNA sequence.

EL626183; SV 1; linear; mRNA; EST; PLN; 841 BP.
EL626183;
EST3689 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167H111, mRNA sequence.

EL626184; SV 1; linear; mRNA; EST; PLN; 450 BP.
EL626184;
EST3690 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B167H121, mRNA sequence.

EL626185; SV 1; linear; mRNA; EST; PLN; 837 BP.
EL626185;
EST3691 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168B011, mRNA sequence.

EL626186; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL626186;
EST3692 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168B061, mRNA sequence.

EL626187; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL626187;
EST3693 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168B101, mRNA sequence.

EL626188; SV 1; linear; mRNA; EST; PLN; 825 BP.
EL626188;
EST3694 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168C031, mRNA sequence.

EL626189; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL626189;
EST3695 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168C091, mRNA sequence.

EL626190; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL626190;
EST3696 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168C121, mRNA sequence.

EL626191; SV 1; linear; mRNA; EST; PLN; 574 BP.
EL626191;
EST3697 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168D031, mRNA sequence.

EL626192; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL626192;
EST3698 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168D091, mRNA sequence.

EL626193; SV 1; linear; mRNA; EST; PLN; 664 BP.
EL626193;
EST3699 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168D101, mRNA sequence.

EL626194; SV 1; linear; mRNA; EST; PLN; 526 BP.
EL626194;
EST3700 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168E021, mRNA sequence.

EL626195; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL626195;
EST3701 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168E061, mRNA sequence.

EL626196; SV 1; linear; mRNA; EST; PLN; 505 BP.
EL626196;
EST3702 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168E071, mRNA sequence.

EL626197; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL626197;
EST3703 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168F091, mRNA sequence.

EL626198; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL626198;
EST3704 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168F101, mRNA sequence.

EL626199; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL626199;
EST3705 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168F111, mRNA sequence.

EL626200; SV 1; linear; mRNA; EST; PLN; 747 BP.
EL626200;
EST3706 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168G091, mRNA sequence.

EL626201; SV 1; linear; mRNA; EST; PLN; 732 BP.
EL626201;
EST3707 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168G121, mRNA sequence.

EL626202; SV 1; linear; mRNA; EST; PLN; 836 BP.
EL626202;
EST3708 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168H011, mRNA sequence.

EL626203; SV 1; linear; mRNA; EST; PLN; 416 BP.
EL626203;
EST3709 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B168H121, mRNA sequence.

EL626204; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL626204;
EST3710 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169A011, mRNA sequence.

EL626205; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL626205;
EST3711 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169A061, mRNA sequence.

EL626206; SV 1; linear; mRNA; EST; PLN; 809 BP.
EL626206;
EST3712 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169A101, mRNA sequence.

EL626207; SV 1; linear; mRNA; EST; PLN; 711 BP.
EL626207;
EST3713 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169A111, mRNA sequence.

EL626208; SV 1; linear; mRNA; EST; PLN; 790 BP.
EL626208;
EST3714 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169B081, mRNA sequence.

EL626209; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL626209;
EST3715 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169C031, mRNA sequence.

EL626210; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL626210;
EST3716 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169D031, mRNA sequence.

EL626211; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL626211;
EST3717 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169D051, mRNA sequence.

EL626212; SV 1; linear; mRNA; EST; PLN; 467 BP.
EL626212;
EST3718 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169D101, mRNA sequence.

EL626213; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL626213;
EST3719 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169D111, mRNA sequence.

EL626214; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL626214;
EST3720 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169E021, mRNA sequence.

EL626215; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL626215;
EST3721 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169F021, mRNA sequence.

EL626216; SV 1; linear; mRNA; EST; PLN; 619 BP.
EL626216;
EST3722 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169F081, mRNA sequence.

EL626217; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL626217;
EST3723 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169G061, mRNA sequence.

EL626218; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL626218;
EST3724 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169G101, mRNA sequence.

EL626219; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL626219;
EST3725 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B169H011, mRNA sequence.

EL626220; SV 1; linear; mRNA; EST; PLN; 659 BP.
EL626220;
EST3726 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170A121, mRNA sequence.

EL626221; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL626221;
EST3727 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170C101, mRNA sequence.

EL626222; SV 1; linear; mRNA; EST; PLN; 656 BP.
EL626222;
EST3728 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170D031, mRNA sequence.

EL626223; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL626223;
EST3729 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170D051, mRNA sequence.

EL626224; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL626224;
EST3730 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170D071, mRNA sequence.

EL626225; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL626225;
EST3731 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170D091, mRNA sequence.

EL626226; SV 1; linear; mRNA; EST; PLN; 621 BP.
EL626226;
EST3732 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170D101, mRNA sequence.

EL626227; SV 1; linear; mRNA; EST; PLN; 611 BP.
EL626227;
EST3733 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170E011, mRNA sequence.

EL626228; SV 1; linear; mRNA; EST; PLN; 603 BP.
EL626228;
EST3734 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170E061, mRNA sequence.

EL626229; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL626229;
EST3735 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170E101, mRNA sequence.

EL626230; SV 1; linear; mRNA; EST; PLN; 393 BP.
EL626230;
EST3736 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170F061, mRNA sequence.

EL626231; SV 1; linear; mRNA; EST; PLN; 471 BP.
EL626231;
EST3737 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170F081, mRNA sequence.

EL626232; SV 1; linear; mRNA; EST; PLN; 479 BP.
EL626232;
EST3738 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170F111, mRNA sequence.

EL626233; SV 1; linear; mRNA; EST; PLN; 427 BP.
EL626233;
EST3739 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170G021, mRNA sequence.

EL626234; SV 1; linear; mRNA; EST; PLN; 441 BP.
EL626234;
EST3740 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170G111, mRNA sequence.

EL626235; SV 1; linear; mRNA; EST; PLN; 575 BP.
EL626235;
EST3741 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B170H111, mRNA sequence.

EL626236; SV 1; linear; mRNA; EST; PLN; 503 BP.
EL626236;
EST3742 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171B011, mRNA sequence.

EL626237; SV 1; linear; mRNA; EST; PLN; 439 BP.
EL626237;
EST3743 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171B021, mRNA sequence.

EL626238; SV 1; linear; mRNA; EST; PLN; 445 BP.
EL626238;
EST3744 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171C011, mRNA sequence.

EL626239; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL626239;
EST3745 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171C021, mRNA sequence.

EL626240; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL626240;
EST3746 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171C061, mRNA sequence.

EL626241; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL626241;
EST3747 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171C111, mRNA sequence.

EL626242; SV 1; linear; mRNA; EST; PLN; 709 BP.
EL626242;
EST3748 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171D041, mRNA sequence.

EL626243; SV 1; linear; mRNA; EST; PLN; 521 BP.
EL626243;
EST3749 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171D081, mRNA sequence.

EL626244; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL626244;
EST3750 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171E041, mRNA sequence.

EL626245; SV 1; linear; mRNA; EST; PLN; 400 BP.
EL626245;
EST3751 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171E121, mRNA sequence.

EL626246; SV 1; linear; mRNA; EST; PLN; 696 BP.
EL626246;
EST3752 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171F031, mRNA sequence.

EL626247; SV 1; linear; mRNA; EST; PLN; 774 BP.
EL626247;
EST3753 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171F051, mRNA sequence.

EL626248; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL626248;
EST3754 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171G021, mRNA sequence.

EL626249; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL626249;
EST3755 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171H051, mRNA sequence.

EL626250; SV 1; linear; mRNA; EST; PLN; 389 BP.
EL626250;
EST3756 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B171H111, mRNA sequence.

EL626251; SV 1; linear; mRNA; EST; PLN; 873 BP.
EL626251;
EST3757 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172A011, mRNA sequence.

EL626252; SV 1; linear; mRNA; EST; PLN; 543 BP.
EL626252;
EST3758 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172A071, mRNA sequence.

EL626253; SV 1; linear; mRNA; EST; PLN; 701 BP.
EL626253;
EST3759 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172B031, mRNA sequence.

EL626254; SV 1; linear; mRNA; EST; PLN; 663 BP.
EL626254;
EST3760 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172D011, mRNA sequence.

EL626255; SV 1; linear; mRNA; EST; PLN; 717 BP.
EL626255;
EST3761 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172D031, mRNA sequence.

EL626256; SV 1; linear; mRNA; EST; PLN; 887 BP.
EL626256;
EST3762 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172D041, mRNA sequence.

EL626257; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL626257;
EST3763 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172D121, mRNA sequence.

EL626258; SV 1; linear; mRNA; EST; PLN; 460 BP.
EL626258;
EST3764 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172E011, mRNA sequence.

EL626259; SV 1; linear; mRNA; EST; PLN; 963 BP.
EL626259;
EST3765 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172E101, mRNA sequence.

EL626260; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL626260;
EST3766 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172E111, mRNA sequence.

EL626261; SV 1; linear; mRNA; EST; PLN; 801 BP.
EL626261;
EST3767 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172F091, mRNA sequence.

EL626262; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL626262;
EST3768 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172G091, mRNA sequence.

EL626263; SV 1; linear; mRNA; EST; PLN; 880 BP.
EL626263;
EST3769 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172H021, mRNA sequence.

EL626264; SV 1; linear; mRNA; EST; PLN; 769 BP.
EL626264;
EST3770 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172H061, mRNA sequence.

EL626265; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL626265;
EST3771 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172H071, mRNA sequence.

EL626266; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL626266;
EST3772 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B172H091, mRNA sequence.

EL626267; SV 1; linear; mRNA; EST; PLN; 815 BP.
EL626267;
EST3773 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B173A051, mRNA sequence.

EL626268; SV 1; linear; mRNA; EST; PLN; 518 BP.
EL626268;
EST3774 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B173A081, mRNA sequence.

EL626269; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL626269;
EST3775 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B173A091, mRNA sequence.

EL626270; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL626270;
EST3776 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B173B021, mRNA sequence.

EL626271; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL626271;
EST3777 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B173G011, mRNA sequence.

EL626272; SV 1; linear; mRNA; EST; PLN; 478 BP.
EL626272;
EST3778 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B173G021, mRNA sequence.

EL626273; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL626273;
EST3779 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B173G031, mRNA sequence.

EL626274; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL626274;
EST3780 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B173H091, mRNA sequence.

EL626275; SV 1; linear; mRNA; EST; PLN; 477 BP.
EL626275;
EST3781 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174A011, mRNA sequence.

EL626276; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL626276;
EST3782 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174A061, mRNA sequence.

EL626277; SV 1; linear; mRNA; EST; PLN; 758 BP.
EL626277;
EST3783 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174B031, mRNA sequence.

EL626278; SV 1; linear; mRNA; EST; PLN; 746 BP.
EL626278;
EST3784 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174C071, mRNA sequence.

EL626279; SV 1; linear; mRNA; EST; PLN; 608 BP.
EL626279;
EST3785 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174C091, mRNA sequence.

EL626280; SV 1; linear; mRNA; EST; PLN; 758 BP.
EL626280;
EST3786 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174C111, mRNA sequence.

EL626281; SV 1; linear; mRNA; EST; PLN; 669 BP.
EL626281;
EST3787 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174D031, mRNA sequence.

EL626282; SV 1; linear; mRNA; EST; PLN; 720 BP.
EL626282;
EST3788 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174E081, mRNA sequence.

EL626283; SV 1; linear; mRNA; EST; PLN; 756 BP.
EL626283;
EST3789 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174E091, mRNA sequence.

EL626284; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL626284;
EST3790 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174F011, mRNA sequence.

EL626285; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL626285;
EST3791 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174F051, mRNA sequence.

EL626286; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL626286;
EST3792 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174F071, mRNA sequence.

EL626287; SV 1; linear; mRNA; EST; PLN; 777 BP.
EL626287;
EST3793 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174F081, mRNA sequence.

EL626288; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL626288;
EST3794 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174G031, mRNA sequence.

EL626289; SV 1; linear; mRNA; EST; PLN; 458 BP.
EL626289;
EST3795 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174H011, mRNA sequence.

EL626290; SV 1; linear; mRNA; EST; PLN; 381 BP.
EL626290;
EST3796 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B174H041, mRNA sequence.

EL626291; SV 1; linear; mRNA; EST; PLN; 642 BP.
EL626291;
EST3797 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175B081, mRNA sequence.

EL626292; SV 1; linear; mRNA; EST; PLN; 501 BP.
EL626292;
EST3798 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175C041, mRNA sequence.

EL626293; SV 1; linear; mRNA; EST; PLN; 572 BP.
EL626293;
EST3799 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175D051, mRNA sequence.

EL626294; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL626294;
EST3800 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175D121, mRNA sequence.

EL626295; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL626295;
EST3801 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175E021, mRNA sequence.

EL626296; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL626296;
EST3802 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175F031, mRNA sequence.

EL626297; SV 1; linear; mRNA; EST; PLN; 495 BP.
EL626297;
EST3803 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175F061, mRNA sequence.

EL626298; SV 1; linear; mRNA; EST; PLN; 592 BP.
EL626298;
EST3804 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175F071, mRNA sequence.

EL626299; SV 1; linear; mRNA; EST; PLN; 670 BP.
EL626299;
EST3805 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B175H111, mRNA sequence.

EL626300; SV 1; linear; mRNA; EST; PLN; 559 BP.
EL626300;
EST3806 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176A011, mRNA sequence.

EL626301; SV 1; linear; mRNA; EST; PLN; 506 BP.
EL626301;
EST3807 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176A021, mRNA sequence.

EL626302; SV 1; linear; mRNA; EST; PLN; 543 BP.
EL626302;
EST3808 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176A071, mRNA sequence.

EL626303; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL626303;
EST3809 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176B121, mRNA sequence.

EL626304; SV 1; linear; mRNA; EST; PLN; 683 BP.
EL626304;
EST3810 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176C041, mRNA sequence.

EL626305; SV 1; linear; mRNA; EST; PLN; 616 BP.
EL626305;
EST3811 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176D041, mRNA sequence.

EL626306; SV 1; linear; mRNA; EST; PLN; 419 BP.
EL626306;
EST3812 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176E021, mRNA sequence.

EL626307; SV 1; linear; mRNA; EST; PLN; 481 BP.
EL626307;
EST3813 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176G041, mRNA sequence.

EL626308; SV 1; linear; mRNA; EST; PLN; 459 BP.
EL626308;
EST3814 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176G071, mRNA sequence.

EL626309; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL626309;
EST3815 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B176G081, mRNA sequence.

EL626310; SV 1; linear; mRNA; EST; PLN; 577 BP.
EL626310;
EST3816 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177A091, mRNA sequence.

EL626311; SV 1; linear; mRNA; EST; PLN; 487 BP.
EL626311;
EST3817 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177A121, mRNA sequence.

EL626312; SV 1; linear; mRNA; EST; PLN; 778 BP.
EL626312;
EST3818 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177B101, mRNA sequence.

EL626313; SV 1; linear; mRNA; EST; PLN; 419 BP.
EL626313;
EST3819 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177C011, mRNA sequence.

EL626314; SV 1; linear; mRNA; EST; PLN; 752 BP.
EL626314;
EST3820 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177C121, mRNA sequence.

EL626315; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL626315;
EST3821 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177D121, mRNA sequence.

EL626316; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL626316;
EST3822 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177E011, mRNA sequence.

EL626317; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL626317;
EST3823 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177E031, mRNA sequence.

EL626318; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL626318;
EST3824 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177E121, mRNA sequence.

EL626319; SV 1; linear; mRNA; EST; PLN; 785 BP.
EL626319;
EST3825 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177F121, mRNA sequence.

EL626320; SV 1; linear; mRNA; EST; PLN; 856 BP.
EL626320;
EST3826 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177H021, mRNA sequence.

EL626321; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL626321;
EST3827 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177H031, mRNA sequence.

EL626322; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL626322;
EST3828 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B177H091, mRNA sequence.

EL626323; SV 1; linear; mRNA; EST; PLN; 809 BP.
EL626323;
EST3829 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178A061, mRNA sequence.

EL626324; SV 1; linear; mRNA; EST; PLN; 457 BP.
EL626324;
EST3830 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178B011, mRNA sequence.

EL626325; SV 1; linear; mRNA; EST; PLN; 802 BP.
EL626325;
EST3831 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178B071, mRNA sequence.

EL626326; SV 1; linear; mRNA; EST; PLN; 788 BP.
EL626326;
EST3832 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178C011, mRNA sequence.

EL626327; SV 1; linear; mRNA; EST; PLN; 708 BP.
EL626327;
EST3833 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178C021, mRNA sequence.

EL626328; SV 1; linear; mRNA; EST; PLN; 743 BP.
EL626328;
EST3834 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178C081, mRNA sequence.

EL626329; SV 1; linear; mRNA; EST; PLN; 780 BP.
EL626329;
EST3835 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178D021, mRNA sequence.

EL626330; SV 1; linear; mRNA; EST; PLN; 464 BP.
EL626330;
EST3836 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178D051, mRNA sequence.

EL626331; SV 1; linear; mRNA; EST; PLN; 793 BP.
EL626331;
EST3837 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178D071, mRNA sequence.

EL626332; SV 1; linear; mRNA; EST; PLN; 773 BP.
EL626332;
EST3838 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178E041, mRNA sequence.

EL626333; SV 1; linear; mRNA; EST; PLN; 423 BP.
EL626333;
EST3839 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178E071, mRNA sequence.

EL626334; SV 1; linear; mRNA; EST; PLN; 1307 BP.
EL626334;
EST3840 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178H021, mRNA sequence.

EL626335; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL626335;
EST3841 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B178H081, mRNA sequence.

EL626336; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL626336;
EST3842 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179A011, mRNA sequence.

EL626337; SV 1; linear; mRNA; EST; PLN; 794 BP.
EL626337;
EST3843 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179B111, mRNA sequence.

EL626338; SV 1; linear; mRNA; EST; PLN; 384 BP.
EL626338;
EST3844 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179C091, mRNA sequence.

EL626339; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL626339;
EST3845 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179D021, mRNA sequence.

EL626340; SV 1; linear; mRNA; EST; PLN; 548 BP.
EL626340;
EST3846 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179D041, mRNA sequence.

EL626341; SV 1; linear; mRNA; EST; PLN; 771 BP.
EL626341;
EST3847 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179D101, mRNA sequence.

EL626342; SV 1; linear; mRNA; EST; PLN; 794 BP.
EL626342;
EST3848 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179E021, mRNA sequence.

EL626343; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL626343;
EST3849 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179E111, mRNA sequence.

EL626344; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL626344;
EST3850 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179F031, mRNA sequence.

EL626345; SV 1; linear; mRNA; EST; PLN; 814 BP.
EL626345;
EST3851 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179F041, mRNA sequence.

EL626346; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL626346;
EST3852 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179F111, mRNA sequence.

EL626347; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL626347;
EST3853 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179H071, mRNA sequence.

EL626348; SV 1; linear; mRNA; EST; PLN; 740 BP.
EL626348;
EST3854 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B179H111, mRNA sequence.

EL626349; SV 1; linear; mRNA; EST; PLN; 395 BP.
EL626349;
EST3855 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180A071, mRNA sequence.

EL626350; SV 1; linear; mRNA; EST; PLN; 732 BP.
EL626350;
EST3856 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180A111, mRNA sequence.

EL626351; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL626351;
EST3857 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180B071, mRNA sequence.

EL626352; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL626352;
EST3858 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180B101, mRNA sequence.

EL626353; SV 1; linear; mRNA; EST; PLN; 648 BP.
EL626353;
EST3859 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180C021, mRNA sequence.

EL626354; SV 1; linear; mRNA; EST; PLN; 839 BP.
EL626354;
EST3860 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180C101, mRNA sequence.

EL626355; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL626355;
EST3861 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180D011, mRNA sequence.

EL626356; SV 1; linear; mRNA; EST; PLN; 609 BP.
EL626356;
EST3862 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180D101, mRNA sequence.

EL626357; SV 1; linear; mRNA; EST; PLN; 661 BP.
EL626357;
EST3863 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180E091, mRNA sequence.

EL626358; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL626358;
EST3864 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180F061, mRNA sequence.

EL626359; SV 1; linear; mRNA; EST; PLN; 830 BP.
EL626359;
EST3865 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180F081, mRNA sequence.

EL626360; SV 1; linear; mRNA; EST; PLN; 627 BP.
EL626360;
EST3866 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180F091, mRNA sequence.

EL626361; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL626361;
EST3867 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180F101, mRNA sequence.

EL626362; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL626362;
EST3868 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180H011, mRNA sequence.

EL626363; SV 1; linear; mRNA; EST; PLN; 744 BP.
EL626363;
EST3869 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180H031, mRNA sequence.

EL626364; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL626364;
EST3870 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B180H071, mRNA sequence.

EL626365; SV 1; linear; mRNA; EST; PLN; 642 BP.
EL626365;
EST3871 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181A111, mRNA sequence.

EL626366; SV 1; linear; mRNA; EST; PLN; 606 BP.
EL626366;
EST3872 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181B081, mRNA sequence.

EL626367; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL626367;
EST3873 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181C121, mRNA sequence.

EL626368; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL626368;
EST3874 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181D021, mRNA sequence.

EL626369; SV 1; linear; mRNA; EST; PLN; 827 BP.
EL626369;
EST3875 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181D061, mRNA sequence.

EL626370; SV 1; linear; mRNA; EST; PLN; 738 BP.
EL626370;
EST3876 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181D081, mRNA sequence.

EL626371; SV 1; linear; mRNA; EST; PLN; 845 BP.
EL626371;
EST3877 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181D101, mRNA sequence.

EL626372; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL626372;
EST3878 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181D111, mRNA sequence.

EL626373; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL626373;
EST3879 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181E111, mRNA sequence.

EL626374; SV 1; linear; mRNA; EST; PLN; 815 BP.
EL626374;
EST3880 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181F011, mRNA sequence.

EL626375; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL626375;
EST3881 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181F031, mRNA sequence.

EL626376; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL626376;
EST3882 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181F041, mRNA sequence.

EL626377; SV 1; linear; mRNA; EST; PLN; 898 BP.
EL626377;
EST3883 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181F061, mRNA sequence.

EL626378; SV 1; linear; mRNA; EST; PLN; 890 BP.
EL626378;
EST3884 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181F101, mRNA sequence.

EL626379; SV 1; linear; mRNA; EST; PLN; 880 BP.
EL626379;
EST3885 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181G011, mRNA sequence.

EL626380; SV 1; linear; mRNA; EST; PLN; 875 BP.
EL626380;
EST3886 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181G021, mRNA sequence.

EL626381; SV 1; linear; mRNA; EST; PLN; 901 BP.
EL626381;
EST3887 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B181G071, mRNA sequence.

EL626382; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL626382;
EST3888 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182A021, mRNA sequence.

EL626383; SV 1; linear; mRNA; EST; PLN; 858 BP.
EL626383;
EST3889 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182B051, mRNA sequence.

EL626384; SV 1; linear; mRNA; EST; PLN; 527 BP.
EL626384;
EST3890 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182C031, mRNA sequence.

EL626385; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL626385;
EST3891 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182C041, mRNA sequence.

EL626386; SV 1; linear; mRNA; EST; PLN; 773 BP.
EL626386;
EST3892 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182C061, mRNA sequence.

EL626387; SV 1; linear; mRNA; EST; PLN; 629 BP.
EL626387;
EST3893 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182E031, mRNA sequence.

EL626388; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL626388;
EST3894 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182F041, mRNA sequence.

EL626389; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL626389;
EST3895 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182G041, mRNA sequence.

EL626390; SV 1; linear; mRNA; EST; PLN; 425 BP.
EL626390;
EST3896 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182G071, mRNA sequence.

EL626391; SV 1; linear; mRNA; EST; PLN; 552 BP.
EL626391;
EST3897 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182G091, mRNA sequence.

EL626392; SV 1; linear; mRNA; EST; PLN; 413 BP.
EL626392;
EST3898 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B182H041, mRNA sequence.

EL626393; SV 1; linear; mRNA; EST; PLN; 529 BP.
EL626393;
EST3899 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183A041, mRNA sequence.

EL626394; SV 1; linear; mRNA; EST; PLN; 493 BP.
EL626394;
EST3900 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183A101, mRNA sequence.

EL626395; SV 1; linear; mRNA; EST; PLN; 650 BP.
EL626395;
EST3901 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183A121, mRNA sequence.

EL626396; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL626396;
EST3902 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183B041, mRNA sequence.

EL626397; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL626397;
EST3903 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183B101, mRNA sequence.

EL626398; SV 1; linear; mRNA; EST; PLN; 405 BP.
EL626398;
EST3904 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183B121, mRNA sequence.

EL626399; SV 1; linear; mRNA; EST; PLN; 616 BP.
EL626399;
EST3905 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183C021, mRNA sequence.

EL626400; SV 1; linear; mRNA; EST; PLN; 480 BP.
EL626400;
EST3906 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183C031, mRNA sequence.

EL626401; SV 1; linear; mRNA; EST; PLN; 676 BP.
EL626401;
EST3907 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183C121, mRNA sequence.

EL626402; SV 1; linear; mRNA; EST; PLN; 640 BP.
EL626402;
EST3908 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183D071, mRNA sequence.

EL626403; SV 1; linear; mRNA; EST; PLN; 537 BP.
EL626403;
EST3909 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183E041, mRNA sequence.

EL626404; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL626404;
EST3910 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183E091, mRNA sequence.

EL626405; SV 1; linear; mRNA; EST; PLN; 469 BP.
EL626405;
EST3911 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183F011, mRNA sequence.

EL626406; SV 1; linear; mRNA; EST; PLN; 612 BP.
EL626406;
EST3912 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183F091, mRNA sequence.

EL626407; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL626407;
EST3913 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183F121, mRNA sequence.

EL626408; SV 1; linear; mRNA; EST; PLN; 647 BP.
EL626408;
EST3914 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B183G101, mRNA sequence.

EL626409; SV 1; linear; mRNA; EST; PLN; 714 BP.
EL626409;
EST3915 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184A021, mRNA sequence.

EL626410; SV 1; linear; mRNA; EST; PLN; 675 BP.
EL626410;
EST3916 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184B021, mRNA sequence.

EL626411; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL626411;
EST3917 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184B101, mRNA sequence.

EL626412; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL626412;
EST3918 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184B111, mRNA sequence.

EL626413; SV 1; linear; mRNA; EST; PLN; 752 BP.
EL626413;
EST3919 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184C101, mRNA sequence.

EL626414; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL626414;
EST3920 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184D081, mRNA sequence.

EL626415; SV 1; linear; mRNA; EST; PLN; 741 BP.
EL626415;
EST3921 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184D101, mRNA sequence.

EL626416; SV 1; linear; mRNA; EST; PLN; 678 BP.
EL626416;
EST3922 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184E081, mRNA sequence.

EL626417; SV 1; linear; mRNA; EST; PLN; 663 BP.
EL626417;
EST3923 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184E101, mRNA sequence.

EL626418; SV 1; linear; mRNA; EST; PLN; 697 BP.
EL626418;
EST3924 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184E111, mRNA sequence.

EL626419; SV 1; linear; mRNA; EST; PLN; 705 BP.
EL626419;
EST3925 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184E121, mRNA sequence.

EL626420; SV 1; linear; mRNA; EST; PLN; 838 BP.
EL626420;
EST3926 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184F091, mRNA sequence.

EL626421; SV 1; linear; mRNA; EST; PLN; 731 BP.
EL626421;
EST3927 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184F121, mRNA sequence.

EL626422; SV 1; linear; mRNA; EST; PLN; 614 BP.
EL626422;
EST3928 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184G041, mRNA sequence.

EL626423; SV 1; linear; mRNA; EST; PLN; 694 BP.
EL626423;
EST3929 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184G061, mRNA sequence.

EL626424; SV 1; linear; mRNA; EST; PLN; 679 BP.
EL626424;
EST3930 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184H031, mRNA sequence.

EL626425; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL626425;
EST3931 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184H061, mRNA sequence.

EL626426; SV 1; linear; mRNA; EST; PLN; 681 BP.
EL626426;
EST3932 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184H081, mRNA sequence.

EL626427; SV 1; linear; mRNA; EST; PLN; 685 BP.
EL626427;
EST3933 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B184H101, mRNA sequence.

EL626428; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL626428;
EST3934 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185A021, mRNA sequence.

EL626429; SV 1; linear; mRNA; EST; PLN; 558 BP.
EL626429;
EST3935 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185A071, mRNA sequence.

EL626430; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL626430;
EST3936 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185B051, mRNA sequence.

EL626431; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL626431;
EST3937 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185B081, mRNA sequence.

EL626432; SV 1; linear; mRNA; EST; PLN; 611 BP.
EL626432;
EST3938 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185C041, mRNA sequence.

EL626433; SV 1; linear; mRNA; EST; PLN; 482 BP.
EL626433;
EST3939 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185C051, mRNA sequence.

EL626434; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL626434;
EST3940 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185D091, mRNA sequence.

EL626435; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL626435;
EST3941 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185F121, mRNA sequence.

EL626436; SV 1; linear; mRNA; EST; PLN; 539 BP.
EL626436;
EST3942 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185G121, mRNA sequence.

EL626437; SV 1; linear; mRNA; EST; PLN; 309 BP.
EL626437;
EST3943 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185H011, mRNA sequence.

EL626438; SV 1; linear; mRNA; EST; PLN; 496 BP.
EL626438;
EST3944 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185H031, mRNA sequence.

EL626439; SV 1; linear; mRNA; EST; PLN; 673 BP.
EL626439;
EST3945 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185H101, mRNA sequence.

EL626440; SV 1; linear; mRNA; EST; PLN; 549 BP.
EL626440;
EST3946 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B185H121, mRNA sequence.

EL626441; SV 1; linear; mRNA; EST; PLN; 461 BP.
EL626441;
EST3947 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186A111, mRNA sequence.

EL626442; SV 1; linear; mRNA; EST; PLN; 794 BP.
EL626442;
EST3948 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186B011, mRNA sequence.

EL626443; SV 1; linear; mRNA; EST; PLN; 399 BP.
EL626443;
EST3949 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186C061, mRNA sequence.

EL626444; SV 1; linear; mRNA; EST; PLN; 443 BP.
EL626444;
EST3950 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186C101, mRNA sequence.

EL626445; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL626445;
EST3951 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186D021, mRNA sequence.

EL626446; SV 1; linear; mRNA; EST; PLN; 748 BP.
EL626446;
EST3952 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186D041, mRNA sequence.

EL626447; SV 1; linear; mRNA; EST; PLN; 427 BP.
EL626447;
EST3953 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186D061, mRNA sequence.

EL626448; SV 1; linear; mRNA; EST; PLN; 739 BP.
EL626448;
EST3954 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186D071, mRNA sequence.

EL626449; SV 1; linear; mRNA; EST; PLN; 633 BP.
EL626449;
EST3955 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186E061, mRNA sequence.

EL626450; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL626450;
EST3956 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186F011, mRNA sequence.

EL626451; SV 1; linear; mRNA; EST; PLN; 535 BP.
EL626451;
EST3957 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186F021, mRNA sequence.

EL626452; SV 1; linear; mRNA; EST; PLN; 646 BP.
EL626452;
EST3958 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186F041, mRNA sequence.

EL626453; SV 1; linear; mRNA; EST; PLN; 511 BP.
EL626453;
EST3959 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186G021, mRNA sequence.

EL626454; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL626454;
EST3960 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186G031, mRNA sequence.

EL626455; SV 1; linear; mRNA; EST; PLN; 775 BP.
EL626455;
EST3961 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186G041, mRNA sequence.

EL626456; SV 1; linear; mRNA; EST; PLN; 576 BP.
EL626456;
EST3962 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186G061, mRNA sequence.

EL626457; SV 1; linear; mRNA; EST; PLN; 462 BP.
EL626457;
EST3963 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186G081, mRNA sequence.

EL626458; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL626458;
EST3964 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186G101, mRNA sequence.

EL626459; SV 1; linear; mRNA; EST; PLN; 715 BP.
EL626459;
EST3965 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186G121, mRNA sequence.

EL626460; SV 1; linear; mRNA; EST; PLN; 485 BP.
EL626460;
EST3966 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186H101, mRNA sequence.

EL626461; SV 1; linear; mRNA; EST; PLN; 785 BP.
EL626461;
EST3967 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B186H121, mRNA sequence.

EL626462; SV 1; linear; mRNA; EST; PLN; 774 BP.
EL626462;
EST3968 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187A041, mRNA sequence.

EL626463; SV 1; linear; mRNA; EST; PLN; 791 BP.
EL626463;
EST3969 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187A071, mRNA sequence.

EL626464; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL626464;
EST3970 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187A081, mRNA sequence.

EL626465; SV 1; linear; mRNA; EST; PLN; 736 BP.
EL626465;
EST3971 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187A121, mRNA sequence.

EL626466; SV 1; linear; mRNA; EST; PLN; 854 BP.
EL626466;
EST3972 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187B011, mRNA sequence.

EL626467; SV 1; linear; mRNA; EST; PLN; 734 BP.
EL626467;
EST3973 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187B061, mRNA sequence.

EL626468; SV 1; linear; mRNA; EST; PLN; 754 BP.
EL626468;
EST3974 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187C041, mRNA sequence.

EL626469; SV 1; linear; mRNA; EST; PLN; 757 BP.
EL626469;
EST3975 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187C051, mRNA sequence.

EL626470; SV 1; linear; mRNA; EST; PLN; 730 BP.
EL626470;
EST3976 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187C091, mRNA sequence.

EL626471; SV 1; linear; mRNA; EST; PLN; 742 BP.
EL626471;
EST3977 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187C111, mRNA sequence.

EL626472; SV 1; linear; mRNA; EST; PLN; 629 BP.
EL626472;
EST3978 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187D021, mRNA sequence.

EL626473; SV 1; linear; mRNA; EST; PLN; 725 BP.
EL626473;
EST3979 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187D041, mRNA sequence.

EL626474; SV 1; linear; mRNA; EST; PLN; 745 BP.
EL626474;
EST3980 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187D091, mRNA sequence.

EL626475; SV 1; linear; mRNA; EST; PLN; 451 BP.
EL626475;
EST3981 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187E051, mRNA sequence.

EL626476; SV 1; linear; mRNA; EST; PLN; 707 BP.
EL626476;
EST3982 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187E071, mRNA sequence.

EL626477; SV 1; linear; mRNA; EST; PLN; 860 BP.
EL626477;
EST3983 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187E101, mRNA sequence.

EL626478; SV 1; linear; mRNA; EST; PLN; 804 BP.
EL626478;
EST3984 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187F101, mRNA sequence.

EL626479; SV 1; linear; mRNA; EST; PLN; 575 BP.
EL626479;
EST3985 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187F111, mRNA sequence.

EL626480; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL626480;
EST3986 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187G011, mRNA sequence.

EL626481; SV 1; linear; mRNA; EST; PLN; 795 BP.
EL626481;
EST3987 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187G101, mRNA sequence.

EL626482; SV 1; linear; mRNA; EST; PLN; 490 BP.
EL626482;
EST3988 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187G111, mRNA sequence.

EL626483; SV 1; linear; mRNA; EST; PLN; 982 BP.
EL626483;
EST3989 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187G121, mRNA sequence.

EL626484; SV 1; linear; mRNA; EST; PLN; 616 BP.
EL626484;
EST3990 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187H081, mRNA sequence.

EL626485; SV 1; linear; mRNA; EST; PLN; 777 BP.
EL626485;
EST3991 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B187H121, mRNA sequence.

EL626486; SV 1; linear; mRNA; EST; PLN; 586 BP.
EL626486;
EST3992 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188A011, mRNA sequence.

EL626487; SV 1; linear; mRNA; EST; PLN; 802 BP.
EL626487;
EST3993 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188A061, mRNA sequence.

EL626488; SV 1; linear; mRNA; EST; PLN; 1498 BP.
EL626488;
EST3994 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188A091, mRNA sequence.

EL626489; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL626489;
EST3995 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188B101, mRNA sequence.

EL626490; SV 1; linear; mRNA; EST; PLN; 509 BP.
EL626490;
EST3996 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188C051, mRNA sequence.

EL626491; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL626491;
EST3997 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188C071, mRNA sequence.

EL626492; SV 1; linear; mRNA; EST; PLN; 556 BP.
EL626492;
EST3998 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188C081, mRNA sequence.

EL626493; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL626493;
EST3999 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188C091, mRNA sequence.

EL626494; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL626494;
EST4000 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188D011, mRNA sequence.

EL626495; SV 1; linear; mRNA; EST; PLN; 662 BP.
EL626495;
EST4001 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188E021, mRNA sequence.

EL626496; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL626496;
EST4002 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188E061, mRNA sequence.

EL626497; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL626497;
EST4003 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188E071, mRNA sequence.

EL626498; SV 1; linear; mRNA; EST; PLN; 465 BP.
EL626498;
EST4004 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188E081, mRNA sequence.

EL626499; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL626499;
EST4005 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188E101, mRNA sequence.

EL626500; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL626500;
EST4006 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188E111, mRNA sequence.

EL626501; SV 1; linear; mRNA; EST; PLN; 780 BP.
EL626501;
EST4007 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188E121, mRNA sequence.

EL626502; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL626502;
EST4008 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188F011, mRNA sequence.

EL626503; SV 1; linear; mRNA; EST; PLN; 743 BP.
EL626503;
EST4009 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188F021, mRNA sequence.

EL626504; SV 1; linear; mRNA; EST; PLN; 794 BP.
EL626504;
EST4010 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188F061, mRNA sequence.

EL626505; SV 1; linear; mRNA; EST; PLN; 786 BP.
EL626505;
EST4011 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188F071, mRNA sequence.

EL626506; SV 1; linear; mRNA; EST; PLN; 785 BP.
EL626506;
EST4012 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188F121, mRNA sequence.

EL626507; SV 1; linear; mRNA; EST; PLN; 727 BP.
EL626507;
EST4013 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188G011, mRNA sequence.

EL626508; SV 1; linear; mRNA; EST; PLN; 787 BP.
EL626508;
EST4014 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188G031, mRNA sequence.

EL626509; SV 1; linear; mRNA; EST; PLN; 644 BP.
EL626509;
EST4015 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188G061, mRNA sequence.

EL626510; SV 1; linear; mRNA; EST; PLN; 805 BP.
EL626510;
EST4016 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188G071, mRNA sequence.

EL626511; SV 1; linear; mRNA; EST; PLN; 1465 BP.
EL626511;
EST4017 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188G121, mRNA sequence.

EL626512; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL626512;
EST4018 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188H031, mRNA sequence.

EL626513; SV 1; linear; mRNA; EST; PLN; 806 BP.
EL626513;
EST4019 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188H061, mRNA sequence.

EL626514; SV 1; linear; mRNA; EST; PLN; 792 BP.
EL626514;
EST4020 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B188H081, mRNA sequence.

EL626515; SV 1; linear; mRNA; EST; PLN; 774 BP.
EL626515;
EST4021 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189A011, mRNA sequence.

EL626516; SV 1; linear; mRNA; EST; PLN; 818 BP.
EL626516;
EST4022 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189A081, mRNA sequence.

EL626517; SV 1; linear; mRNA; EST; PLN; 786 BP.
EL626517;
EST4023 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189A121, mRNA sequence.

EL626518; SV 1; linear; mRNA; EST; PLN; 839 BP.
EL626518;
EST4024 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189B071, mRNA sequence.

EL626519; SV 1; linear; mRNA; EST; PLN; 523 BP.
EL626519;
EST4025 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189B081, mRNA sequence.

EL626520; SV 1; linear; mRNA; EST; PLN; 507 BP.
EL626520;
EST4026 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189B121, mRNA sequence.

EL626521; SV 1; linear; mRNA; EST; PLN; 409 BP.
EL626521;
EST4027 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189C031, mRNA sequence.

EL626522; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL626522;
EST4028 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189C041, mRNA sequence.

EL626523; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL626523;
EST4029 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189C071, mRNA sequence.

EL626524; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL626524;
EST4030 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189C081, mRNA sequence.

EL626525; SV 1; linear; mRNA; EST; PLN; 626 BP.
EL626525;
EST4031 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189C091, mRNA sequence.

EL626526; SV 1; linear; mRNA; EST; PLN; 763 BP.
EL626526;
EST4032 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189D031, mRNA sequence.

EL626527; SV 1; linear; mRNA; EST; PLN; 635 BP.
EL626527;
EST4033 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189D061, mRNA sequence.

EL626528; SV 1; linear; mRNA; EST; PLN; 793 BP.
EL626528;
EST4034 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189D091, mRNA sequence.

EL626529; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL626529;
EST4035 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189D111, mRNA sequence.

EL626530; SV 1; linear; mRNA; EST; PLN; 781 BP.
EL626530;
EST4036 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189E011, mRNA sequence.

EL626531; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL626531;
EST4037 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189E071, mRNA sequence.

EL626532; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL626532;
EST4038 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189F021, mRNA sequence.

EL626533; SV 1; linear; mRNA; EST; PLN; 832 BP.
EL626533;
EST4039 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189F081, mRNA sequence.

EL626534; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL626534;
EST4040 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189G011, mRNA sequence.

EL626535; SV 1; linear; mRNA; EST; PLN; 490 BP.
EL626535;
EST4041 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189G031, mRNA sequence.

EL626536; SV 1; linear; mRNA; EST; PLN; 610 BP.
EL626536;
EST4042 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189G061, mRNA sequence.

EL626537; SV 1; linear; mRNA; EST; PLN; 800 BP.
EL626537;
EST4043 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189G101, mRNA sequence.

EL626538; SV 1; linear; mRNA; EST; PLN; 802 BP.
EL626538;
EST4044 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189H051, mRNA sequence.

EL626539; SV 1; linear; mRNA; EST; PLN; 622 BP.
EL626539;
EST4045 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189H061, mRNA sequence.

EL626540; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL626540;
EST4046 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B189H121, mRNA sequence.

EL626541; SV 1; linear; mRNA; EST; PLN; 538 BP.
EL626541;
EST4047 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190A011, mRNA sequence.

EL626542; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL626542;
EST4048 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190A031, mRNA sequence.

EL626543; SV 1; linear; mRNA; EST; PLN; 597 BP.
EL626543;
EST4049 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190A051, mRNA sequence.

EL626544; SV 1; linear; mRNA; EST; PLN; 532 BP.
EL626544;
EST4050 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190A061, mRNA sequence.

EL626545; SV 1; linear; mRNA; EST; PLN; 544 BP.
EL626545;
EST4051 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190B011, mRNA sequence.

EL626546; SV 1; linear; mRNA; EST; PLN; 798 BP.
EL626546;
EST4052 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190B031, mRNA sequence.

EL626547; SV 1; linear; mRNA; EST; PLN; 390 BP.
EL626547;
EST4053 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190B061, mRNA sequence.

EL626548; SV 1; linear; mRNA; EST; PLN; 542 BP.
EL626548;
EST4054 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190B081, mRNA sequence.

EL626549; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL626549;
EST4055 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190B101, mRNA sequence.

EL626550; SV 1; linear; mRNA; EST; PLN; 639 BP.
EL626550;
EST4056 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190C041, mRNA sequence.

EL626551; SV 1; linear; mRNA; EST; PLN; 797 BP.
EL626551;
EST4057 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190C071, mRNA sequence.

EL626552; SV 1; linear; mRNA; EST; PLN; 584 BP.
EL626552;
EST4058 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190C091, mRNA sequence.

EL626553; SV 1; linear; mRNA; EST; PLN; 409 BP.
EL626553;
EST4059 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190D081, mRNA sequence.

EL626554; SV 1; linear; mRNA; EST; PLN; 541 BP.
EL626554;
EST4060 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190D121, mRNA sequence.

EL626555; SV 1; linear; mRNA; EST; PLN; 883 BP.
EL626555;
EST4061 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190E021, mRNA sequence.

EL626556; SV 1; linear; mRNA; EST; PLN; 547 BP.
EL626556;
EST4062 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190E031, mRNA sequence.

EL626557; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL626557;
EST4063 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190E061, mRNA sequence.

EL626558; SV 1; linear; mRNA; EST; PLN; 656 BP.
EL626558;
EST4064 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190E111, mRNA sequence.

EL626559; SV 1; linear; mRNA; EST; PLN; 588 BP.
EL626559;
EST4065 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190F071, mRNA sequence.

EL626560; SV 1; linear; mRNA; EST; PLN; 516 BP.
EL626560;
EST4066 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190F081, mRNA sequence.

EL626561; SV 1; linear; mRNA; EST; PLN; 709 BP.
EL626561;
EST4067 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190G021, mRNA sequence.

EL626562; SV 1; linear; mRNA; EST; PLN; 848 BP.
EL626562;
EST4068 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190H041, mRNA sequence.

EL626563; SV 1; linear; mRNA; EST; PLN; 894 BP.
EL626563;
EST4069 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190H081, mRNA sequence.

EL626564; SV 1; linear; mRNA; EST; PLN; 673 BP.
EL626564;
EST4070 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B190H121, mRNA sequence.

EL626565; SV 1; linear; mRNA; EST; PLN; 767 BP.
EL626565;
EST4071 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191A061, mRNA sequence.

EL626566; SV 1; linear; mRNA; EST; PLN; 849 BP.
EL626566;
EST4072 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191A081, mRNA sequence.

EL626567; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL626567;
EST4073 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191A111, mRNA sequence.

EL626568; SV 1; linear; mRNA; EST; PLN; 794 BP.
EL626568;
EST4074 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191A121, mRNA sequence.

EL626569; SV 1; linear; mRNA; EST; PLN; 790 BP.
EL626569;
EST4075 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191B031, mRNA sequence.

EL626570; SV 1; linear; mRNA; EST; PLN; 434 BP.
EL626570;
EST4076 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191B081, mRNA sequence.

EL626571; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL626571;
EST4077 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191B101, mRNA sequence.

EL626572; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL626572;
EST4078 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191B121, mRNA sequence.

EL626573; SV 1; linear; mRNA; EST; PLN; 700 BP.
EL626573;
EST4079 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191C041, mRNA sequence.

EL626574; SV 1; linear; mRNA; EST; PLN; 790 BP.
EL626574;
EST4080 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191C061, mRNA sequence.

EL626575; SV 1; linear; mRNA; EST; PLN; 451 BP.
EL626575;
EST4081 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191C071, mRNA sequence.

EL626576; SV 1; linear; mRNA; EST; PLN; 491 BP.
EL626576;
EST4082 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191C081, mRNA sequence.

EL626577; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL626577;
EST4083 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191C091, mRNA sequence.

EL626578; SV 1; linear; mRNA; EST; PLN; 551 BP.
EL626578;
EST4084 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191D011, mRNA sequence.

EL626579; SV 1; linear; mRNA; EST; PLN; 931 BP.
EL626579;
EST4085 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191D021, mRNA sequence.

EL626580; SV 1; linear; mRNA; EST; PLN; 489 BP.
EL626580;
EST4086 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191D031, mRNA sequence.

EL626581; SV 1; linear; mRNA; EST; PLN; 658 BP.
EL626581;
EST4087 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191D111, mRNA sequence.

EL626582; SV 1; linear; mRNA; EST; PLN; 754 BP.
EL626582;
EST4088 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191E011, mRNA sequence.

EL626583; SV 1; linear; mRNA; EST; PLN; 565 BP.
EL626583;
EST4089 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191E021, mRNA sequence.

EL626584; SV 1; linear; mRNA; EST; PLN; 418 BP.
EL626584;
EST4090 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191E031, mRNA sequence.

EL626585; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL626585;
EST4091 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191E081, mRNA sequence.

EL626586; SV 1; linear; mRNA; EST; PLN; 488 BP.
EL626586;
EST4092 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191E111, mRNA sequence.

EL626587; SV 1; linear; mRNA; EST; PLN; 692 BP.
EL626587;
EST4093 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191E121, mRNA sequence.

EL626588; SV 1; linear; mRNA; EST; PLN; 578 BP.
EL626588;
EST4094 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191F021, mRNA sequence.

EL626589; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL626589;
EST4095 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191F111, mRNA sequence.

EL626590; SV 1; linear; mRNA; EST; PLN; 796 BP.
EL626590;
EST4096 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191G061, mRNA sequence.

EL626591; SV 1; linear; mRNA; EST; PLN; 404 BP.
EL626591;
EST4097 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B191H011, mRNA sequence.

EL626592; SV 1; linear; mRNA; EST; PLN; 510 BP.
EL626592;
EST4098 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192A031, mRNA sequence.

EL626593; SV 1; linear; mRNA; EST; PLN; 499 BP.
EL626593;
EST4099 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192A041, mRNA sequence.

EL626594; SV 1; linear; mRNA; EST; PLN; 760 BP.
EL626594;
EST4100 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192A081, mRNA sequence.

EL626595; SV 1; linear; mRNA; EST; PLN; 847 BP.
EL626595;
EST4101 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192A091, mRNA sequence.

EL626596; SV 1; linear; mRNA; EST; PLN; 634 BP.
EL626596;
EST4102 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192A101, mRNA sequence.

EL626597; SV 1; linear; mRNA; EST; PLN; 561 BP.
EL626597;
EST4103 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192B021, mRNA sequence.

EL626598; SV 1; linear; mRNA; EST; PLN; 546 BP.
EL626598;
EST4104 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192B041, mRNA sequence.

EL626599; SV 1; linear; mRNA; EST; PLN; 607 BP.
EL626599;
EST4105 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192B101, mRNA sequence.

EL626600; SV 1; linear; mRNA; EST; PLN; 536 BP.
EL626600;
EST4106 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192B111, mRNA sequence.

EL626601; SV 1; linear; mRNA; EST; PLN; 684 BP.
EL626601;
EST4107 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192C011, mRNA sequence.

EL626602; SV 1; linear; mRNA; EST; PLN; 388 BP.
EL626602;
EST4108 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192C091, mRNA sequence.

EL626603; SV 1; linear; mRNA; EST; PLN; 285 BP.
EL626603;
EST4109 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192C101, mRNA sequence.

EL626604; SV 1; linear; mRNA; EST; PLN; 560 BP.
EL626604;
EST4110 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192D021, mRNA sequence.

EL626605; SV 1; linear; mRNA; EST; PLN; 641 BP.
EL626605;
EST4111 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192D061, mRNA sequence.

EL626606; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL626606;
EST4112 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192D071, mRNA sequence.

EL626607; SV 1; linear; mRNA; EST; PLN; 345 BP.
EL626607;
EST4113 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192D111, mRNA sequence.

EL626608; SV 1; linear; mRNA; EST; PLN; 629 BP.
EL626608;
EST4114 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192E011, mRNA sequence.

EL626609; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL626609;
EST4115 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192E021, mRNA sequence.

EL626610; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL626610;
EST4116 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192E031, mRNA sequence.

EL626611; SV 1; linear; mRNA; EST; PLN; 500 BP.
EL626611;
EST4117 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192E071, mRNA sequence.

EL626612; SV 1; linear; mRNA; EST; PLN; 566 BP.
EL626612;
EST4118 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192E101, mRNA sequence.

EL626613; SV 1; linear; mRNA; EST; PLN; 604 BP.
EL626613;
EST4119 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192F091, mRNA sequence.

EL626614; SV 1; linear; mRNA; EST; PLN; 515 BP.
EL626614;
EST4120 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192F101, mRNA sequence.

EL626615; SV 1; linear; mRNA; EST; PLN; 423 BP.
EL626615;
EST4121 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192G061, mRNA sequence.

EL626616; SV 1; linear; mRNA; EST; PLN; 491 BP.
EL626616;
EST4122 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192G091, mRNA sequence.

EL626617; SV 1; linear; mRNA; EST; PLN; 443 BP.
EL626617;
EST4123 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B192H101, mRNA sequence.

EL626618; SV 1; linear; mRNA; EST; PLN; 634 BP.
EL626618;
EST4124 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193A021, mRNA sequence.

EL626619; SV 1; linear; mRNA; EST; PLN; 478 BP.
EL626619;
EST4125 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193B031, mRNA sequence.

EL626620; SV 1; linear; mRNA; EST; PLN; 834 BP.
EL626620;
EST4126 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193B071, mRNA sequence.

EL626621; SV 1; linear; mRNA; EST; PLN; 417 BP.
EL626621;
EST4127 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193B101, mRNA sequence.

EL626622; SV 1; linear; mRNA; EST; PLN; 226 BP.
EL626622;
EST4128 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193B121, mRNA sequence.

EL626623; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL626623;
EST4129 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193C021, mRNA sequence.

EL626624; SV 1; linear; mRNA; EST; PLN; 758 BP.
EL626624;
EST4130 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193C051, mRNA sequence.

EL626625; SV 1; linear; mRNA; EST; PLN; 718 BP.
EL626625;
EST4131 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193C091, mRNA sequence.

EL626626; SV 1; linear; mRNA; EST; PLN; 437 BP.
EL626626;
EST4132 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193D011, mRNA sequence.

EL626627; SV 1; linear; mRNA; EST; PLN; 703 BP.
EL626627;
EST4133 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193D051, mRNA sequence.

EL626628; SV 1; linear; mRNA; EST; PLN; 761 BP.
EL626628;
EST4134 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193D061, mRNA sequence.

EL626629; SV 1; linear; mRNA; EST; PLN; 492 BP.
EL626629;
EST4135 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193D071, mRNA sequence.

EL626630; SV 1; linear; mRNA; EST; PLN; 784 BP.
EL626630;
EST4136 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193D091, mRNA sequence.

EL626631; SV 1; linear; mRNA; EST; PLN; 728 BP.
EL626631;
EST4137 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193D101, mRNA sequence.

EL626632; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL626632;
EST4138 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193D111, mRNA sequence.

EL626633; SV 1; linear; mRNA; EST; PLN; 455 BP.
EL626633;
EST4139 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193E031, mRNA sequence.

EL626634; SV 1; linear; mRNA; EST; PLN; 452 BP.
EL626634;
EST4140 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193E101, mRNA sequence.

EL626635; SV 1; linear; mRNA; EST; PLN; 591 BP.
EL626635;
EST4141 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193F011, mRNA sequence.

EL626636; SV 1; linear; mRNA; EST; PLN; 735 BP.
EL626636;
EST4142 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193F021, mRNA sequence.

EL626637; SV 1; linear; mRNA; EST; PLN; 795 BP.
EL626637;
EST4143 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193F041, mRNA sequence.

EL626638; SV 1; linear; mRNA; EST; PLN; 789 BP.
EL626638;
EST4144 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193F111, mRNA sequence.

EL626639; SV 1; linear; mRNA; EST; PLN; 531 BP.
EL626639;
EST4145 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193G071, mRNA sequence.

EL626640; SV 1; linear; mRNA; EST; PLN; 555 BP.
EL626640;
EST4146 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193G111, mRNA sequence.

EL626641; SV 1; linear; mRNA; EST; PLN; 737 BP.
EL626641;
EST4147 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193H031, mRNA sequence.

EL626642; SV 1; linear; mRNA; EST; PLN; 719 BP.
EL626642;
EST4148 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193H041, mRNA sequence.

EL626643; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL626643;
EST4149 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193H071, mRNA sequence.

EL626644; SV 1; linear; mRNA; EST; PLN; 520 BP.
EL626644;
EST4150 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193H111, mRNA sequence.

EL626645; SV 1; linear; mRNA; EST; PLN; 383 BP.
EL626645;
EST4151 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B193H121, mRNA sequence.

EL626646; SV 1; linear; mRNA; EST; PLN; 919 BP.
EL626646;
EST4152 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194A011, mRNA sequence.

EL626647; SV 1; linear; mRNA; EST; PLN; 801 BP.
EL626647;
EST4153 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194A031, mRNA sequence.

EL626648; SV 1; linear; mRNA; EST; PLN; 581 BP.
EL626648;
EST4154 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194A051, mRNA sequence.

EL626649; SV 1; linear; mRNA; EST; PLN; 794 BP.
EL626649;
EST4155 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194A071, mRNA sequence.

EL626650; SV 1; linear; mRNA; EST; PLN; 859 BP.
EL626650;
EST4156 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194A101, mRNA sequence.

EL626651; SV 1; linear; mRNA; EST; PLN; 562 BP.
EL626651;
EST4157 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194C081, mRNA sequence.

EL626652; SV 1; linear; mRNA; EST; PLN; 680 BP.
EL626652;
EST4158 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194C091, mRNA sequence.

EL626653; SV 1; linear; mRNA; EST; PLN; 813 BP.
EL626653;
EST4159 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194C101, mRNA sequence.

EL626654; SV 1; linear; mRNA; EST; PLN; 845 BP.
EL626654;
EST4160 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194D011, mRNA sequence.

EL626655; SV 1; linear; mRNA; EST; PLN; 807 BP.
EL626655;
EST4161 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194D021, mRNA sequence.

EL626656; SV 1; linear; mRNA; EST; PLN; 768 BP.
EL626656;
EST4162 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194D051, mRNA sequence.

EL626657; SV 1; linear; mRNA; EST; PLN; 844 BP.
EL626657;
EST4163 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194D061, mRNA sequence.

EL626658; SV 1; linear; mRNA; EST; PLN; 779 BP.
EL626658;
EST4164 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194D071, mRNA sequence.

EL626659; SV 1; linear; mRNA; EST; PLN; 838 BP.
EL626659;
EST4165 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194E011, mRNA sequence.

EL626660; SV 1; linear; mRNA; EST; PLN; 593 BP.
EL626660;
EST4166 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194E041, mRNA sequence.

EL626661; SV 1; linear; mRNA; EST; PLN; 478 BP.
EL626661;
EST4167 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194E051, mRNA sequence.

EL626662; SV 1; linear; mRNA; EST; PLN; 815 BP.
EL626662;
EST4168 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194E061, mRNA sequence.

EL626663; SV 1; linear; mRNA; EST; PLN; 552 BP.
EL626663;
EST4169 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194E091, mRNA sequence.

EL626664; SV 1; linear; mRNA; EST; PLN; 465 BP.
EL626664;
EST4170 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194F011, mRNA sequence.

EL626665; SV 1; linear; mRNA; EST; PLN; 657 BP.
EL626665;
EST4171 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194F051, mRNA sequence.

EL626666; SV 1; linear; mRNA; EST; PLN; 602 BP.
EL626666;
EST4172 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194F101, mRNA sequence.

EL626667; SV 1; linear; mRNA; EST; PLN; 714 BP.
EL626667;
EST4173 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194F121, mRNA sequence.

EL626668; SV 1; linear; mRNA; EST; PLN; 582 BP.
EL626668;
EST4174 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194G011, mRNA sequence.

EL626669; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL626669;
EST4175 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194G041, mRNA sequence.

EL626670; SV 1; linear; mRNA; EST; PLN; 845 BP.
EL626670;
EST4176 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194G061, mRNA sequence.

EL626671; SV 1; linear; mRNA; EST; PLN; 802 BP.
EL626671;
EST4177 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194G081, mRNA sequence.

EL626672; SV 1; linear; mRNA; EST; PLN; 888 BP.
EL626672;
EST4178 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194G101, mRNA sequence.

EL626673; SV 1; linear; mRNA; EST; PLN; 859 BP.
EL626673;
EST4179 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194H031, mRNA sequence.

EL626674; SV 1; linear; mRNA; EST; PLN; 837 BP.
EL626674;
EST4180 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194H051, mRNA sequence.

EL626675; SV 1; linear; mRNA; EST; PLN; 848 BP.
EL626675;
EST4181 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194H061, mRNA sequence.

EL626676; SV 1; linear; mRNA; EST; PLN; 859 BP.
EL626676;
EST4182 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194H071, mRNA sequence.

EL626677; SV 1; linear; mRNA; EST; PLN; 765 BP.
EL626677;
EST4183 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194H081, mRNA sequence.

EL626678; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL626678;
EST4184 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194H091, mRNA sequence.

EL626679; SV 1; linear; mRNA; EST; PLN; 888 BP.
EL626679;
EST4185 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B194H121, mRNA sequence.

EL626680; SV 1; linear; mRNA; EST; PLN; 772 BP.
EL626680;
EST4186 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195A031, mRNA sequence.

EL626681; SV 1; linear; mRNA; EST; PLN; 822 BP.
EL626681;
EST4187 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195A051, mRNA sequence.

EL626682; SV 1; linear; mRNA; EST; PLN; 799 BP.
EL626682;
EST4188 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195A101, mRNA sequence.

EL626683; SV 1; linear; mRNA; EST; PLN; 759 BP.
EL626683;
EST4189 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195B011, mRNA sequence.

EL626684; SV 1; linear; mRNA; EST; PLN; 717 BP.
EL626684;
EST4190 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195B031, mRNA sequence.

EL626685; SV 1; linear; mRNA; EST; PLN; 855 BP.
EL626685;
EST4191 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195B121, mRNA sequence.

EL626686; SV 1; linear; mRNA; EST; PLN; 554 BP.
EL626686;
EST4192 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195C041, mRNA sequence.

EL626687; SV 1; linear; mRNA; EST; PLN; 853 BP.
EL626687;
EST4193 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195C051, mRNA sequence.

EL626688; SV 1; linear; mRNA; EST; PLN; 599 BP.
EL626688;
EST4194 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195C081, mRNA sequence.

EL626689; SV 1; linear; mRNA; EST; PLN; 847 BP.
EL626689;
EST4195 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195D011, mRNA sequence.

EL626690; SV 1; linear; mRNA; EST; PLN; 844 BP.
EL626690;
EST4196 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195D021, mRNA sequence.

EL626691; SV 1; linear; mRNA; EST; PLN; 749 BP.
EL626691;
EST4197 3-9 DAP Brassica Napus seed cDNA library Brassica napus cDNA clone B195D061, mRNA sequence.

EL626692; SV 1; linear; mRNA; EST; PLN; 859 BP.
EL626692;
EST4198 3-9 DAP Brassica Napus seed cDNA library Brassic