[2015|2013]

26/12/2014

KM593132; SV 1; linear; mRNA; STD; PLN; 1565 BP.
KM593132;
Brassica oleracea var. capitata WRKY transcription factor (WRKY7) mRNA, complete cds.

KM593133; SV 1; linear; mRNA; STD; PLN; 1960 BP.
KM593133;
Brassica oleracea var. capitata WRKY transcription factor (WRKY9) mRNA, complete cds.

KM593134; SV 1; linear; mRNA; STD; PLN; 1524 BP.
KM593134;
Brassica oleracea var. capitata WRKY transcription factor (WRKY14) mRNA, complete cds.

KM593135; SV 1; linear; mRNA; STD; PLN; 1846 BP.
KM593135;
Brassica oleracea var. capitata WRKY transcription factor (WRKY17) mRNA, complete cds.

KM593136; SV 1; linear; mRNA; STD; PLN; 2013 BP.
KM593136;
Brassica oleracea var. capitata WRKY transcription factor (WRKY20) mRNA, complete cds.

KM593137; SV 1; linear; mRNA; STD; PLN; 1802 BP.
KM593137;
Brassica oleracea var. capitata WRKY transcription factor (WRKY22) mRNA, complete cds.

KM593138; SV 1; linear; mRNA; STD; PLN; 1622 BP.
KM593138;
Brassica oleracea var. capitata WRKY transcription factor (WRKY28) mRNA, complete cds.

KM593139; SV 1; linear; mRNA; STD; PLN; 1939 BP.
KM593139;
Brassica oleracea var. capitata WRKY transcription factor (WRKY29) mRNA, complete cds.

KM593140; SV 1; linear; mRNA; STD; PLN; 1237 BP.
KM593140;
Brassica oleracea var. capitata WRKY transcription factor (WRKY32) mRNA, complete cds.

KM593141; SV 1; linear; mRNA; STD; PLN; 804 BP.
KM593141;
Brassica oleracea var. capitata WRKY transcription factor (WRKY33) mRNA, partial cds.

KM593142; SV 1; linear; mRNA; STD; PLN; 1593 BP.
KM593142;
Brassica oleracea var. capitata WRKY transcription factor (WRKY35) mRNA, complete cds.

KM593143; SV 1; linear; mRNA; STD; PLN; 985 BP.
KM593143;
Brassica oleracea var. capitata WRKY transcription factor (WRKY40) mRNA, complete cds.

KM593144; SV 1; linear; mRNA; STD; PLN; 1422 BP.
KM593144;
Brassica oleracea var. capitata WRKY transcription factor (WRKY41) mRNA, complete cds.

KM593145; SV 1; linear; mRNA; STD; PLN; 1773 BP.
KM593145;
Brassica oleracea var. capitata WRKY transcription factor (WRKY45) mRNA, complete cds.

KM593146; SV 1; linear; mRNA; STD; PLN; 1419 BP.
KM593146;
Brassica oleracea var. capitata WRKY transcription factor (WRKY51) mRNA, complete cds.

KM593147; SV 1; linear; mRNA; STD; PLN; 1605 BP.
KM593147;
Brassica oleracea var. capitata WRKY transcription factor (WRKY53) mRNA, complete cds.

KM593148; SV 1; linear; mRNA; STD; PLN; 1672 BP.
KM593148;
Brassica oleracea var. capitata WRKY transcription factor (WRKY54) mRNA, complete cds.

KM593149; SV 1; linear; mRNA; STD; PLN; 775 BP.
KM593149;
Brassica oleracea var. capitata WRKY transcription factor (WRKY57) mRNA, complete cds.

KM593150; SV 1; linear; mRNA; STD; PLN; 2025 BP.
KM593150;
Brassica oleracea var. capitata WRKY transcription factor (WRKY58) mRNA, complete cds.

KM593151; SV 1; linear; mRNA; STD; PLN; 1422 BP.
KM593151;
Brassica oleracea var. capitata WRKY transcription factor (WRKY65) mRNA, complete cds.

KM593152; SV 1; linear; mRNA; STD; PLN; 1008 BP.
KM593152;
Brassica oleracea var. capitata WRKY transcription factor (WRKY70) mRNA, complete cds.

KM593153; SV 1; linear; mRNA; STD; PLN; 2064 BP.
KM593153;
Brassica oleracea var. capitata WRKY transcription factor (WRKY72) mRNA, complete cds.

KM593154; SV 1; linear; mRNA; STD; PLN; 1435 BP.
KM593154;
Brassica oleracea var. capitata WRKY transcription factor (WRKY79) mRNA, complete cds. FT                   FSWRKYGQKPIKGSPHPRGYYKCSSMRGCPARKHVERAPDDAMMLIVTYEGDHNHAMVL

KM593155; SV 1; linear; mRNA; STD; PLN; 1830 BP.
KM593155;
Brassica oleracea var. capitata WRKY transcription factor (WRKY81) mRNA, complete cds.

KM593156; SV 1; linear; mRNA; STD; PLN; 2065 BP.
KM593156;
Brassica oleracea var. capitata WRKY transcription factor (WRKY82) mRNA, complete cds.

KM593157; SV 1; linear; mRNA; STD; PLN; 1084 BP.
KM593157;
Brassica oleracea var. capitata WRKY transcription factor (WRKY84) mRNA, complete cds.

KM593158; SV 1; linear; mRNA; STD; PLN; 955 BP.
KM593158;
Brassica oleracea var. capitata WRKY transcription factor (WRKY85) mRNA, complete cds.

KM593159; SV 1; linear; mRNA; STD; PLN; 2114 BP.
KM593159;
Brassica oleracea var. capitata WRKY transcription factor (WRKY87) mRNA, complete cds.

KM593160; SV 1; linear; mRNA; STD; PLN; 583 BP.
KM593160;
Brassica oleracea var. capitata WRKY transcription factor (WRKY92) mRNA, partial cds.

KM593161; SV 1; linear; mRNA; STD; PLN; 1855 BP.
KM593161;
Brassica oleracea var. capitata WRKY transcription factor (WRKY94) mRNA, complete cds.

KM593162; SV 1; linear; mRNA; STD; PLN; 545 BP.
KM593162;
Brassica oleracea var. capitata WRKY transcription factor (WRKY106) mRNA, complete cds.

KM593163; SV 1; linear; mRNA; STD; PLN; 938 BP.
KM593163;
Brassica oleracea var. capitata WRKY transcription factor (WRKY115) mRNA, complete cds.

KM593164; SV 1; linear; mRNA; STD; PLN; 569 BP.
KM593164;
Brassica oleracea var. capitata WRKY transcription factor (WRKY121) mRNA, partial cds.

KM593165; SV 1; linear; mRNA; STD; PLN; 1273 BP.
KM593165;
Brassica oleracea var. capitata WRKY transcription factor (WRKY139) mRNA, partial cds.

KM593166; SV 1; linear; mRNA; STD; PLN; 1652 BP.
KM593166;
Brassica oleracea var. capitata WRKY transcription factor (WRKY140) mRNA, complete cds.

KM593167; SV 1; linear; mRNA; STD; PLN; 2628 BP.
KM593167;
Brassica oleracea var. capitata WRKY transcription factor (WRKY141) mRNA, complete cds.

KM593168; SV 1; linear; mRNA; STD; PLN; 1240 BP.
KM593168;
Brassica oleracea var. capitata WRKY transcription factor (WRKY146) mRNA, complete cds.


25/12/2014

KM586049; SV 1; linear; mRNA; STD; PLN; 1005 BP.
KM586049;
Brassica napus beta-type carbonic anhydrase 1-like protein mRNA, complete cds.

KM586050; SV 1; linear; mRNA; STD; PLN; 780 BP.
KM586050;
Brassica napus beta-type carbonic anhydrase 3-like protein mRNA, complete cds.

KM586051; SV 1; linear; mRNA; STD; PLN; 777 BP.
KM586051;
Brassica napus beta-type carbonic anhydrase 4-like protein mRNA, complete cds.


17/12/2014

KM396887; SV 1; linear; mRNA; STD; PLN; 685 BP.
KM396887;
Brassica rapa ubiquitin-conjugating protein 11 (UBC11) mRNA, complete cds.


13/12/2014

JQ638499;
Brassica rapa retinoblastoma-related protein (A.RBR.a l) mRNA, complete cds, alternatively spliced.

KJ914579; SV 1; linear; genomic DNA; STD; PLN; 1704 BP.
KJ914579;
Brassica napus isolate Digger O-methyltransferase family protein (OMT) gene, complete cds.

KJ914580; SV 1; linear; genomic DNA; STD; PLN; 1704 BP.
KJ914580;
Brassica napus isolate Westar O-methyltransferase family protein (OMT) gene, complete cds.


04/09/2014

JX416331; SV 1; linear; genomic DNA; STD; PLN; 886 BP.
JX416331;
Brassica oleracea S-locus receptor kinase (SRK-16) gene, partial cds.

JX416332; SV 1; linear; genomic DNA; STD; PLN; 898 BP.
JX416332;
Brassica oleracea S-locus receptor kinase (SRK-35) gene, partial cds.

JX416333; SV 1; linear; genomic DNA; STD; PLN; 969 BP.
JX416333;
Brassica oleracea S-locus receptor kinase (SRK-45) gene, partial cds.

JX416334; SV 1; linear; genomic DNA; STD; PLN; 964 BP.
JX416334;
Brassica oleracea S-locus receptor kinase (SRK-50) gene, partial cds.

JX416335; SV 1; linear; genomic DNA; STD; PLN; 890 BP.
JX416335;
Brassica oleracea S-locus receptor kinase (SRK-57) gene, partial cds.

JX840773; SV 1; linear; genomic DNA; STD; PLN; 905 BP.
JX840773;
Brassica oleracea S-locus receptor kinase (SRK) gene, exons 2 through 5 and partial cds.

JX840774; SV 1; linear; genomic DNA; STD; PLN; 2333 BP.
JX840774;
Brassica oleracea S-locus receptor kinase (SRK) gene, exons 1 through 5 and partial cds.

JX840775; SV 1; linear; genomic DNA; STD; PLN; 2250 BP.
JX840775;
UNVERIFIED: Brassica oleracea S-locus receptor kinase-like (SRK) gene, partial sequence.

JX861859; SV 1; linear; genomic DNA; STD; PLN; 1220 BP.
JX861859;
Brassica oleracea S-locus receptor kinase (SRK) gene, exon 1 and partial cds.


28/08/2014

KF031944; SV 1; linear; mRNA; STD; PLN; 1554 BP.
KF031944;
Brassica oleracea cultivar Zhonggan 11 aluminum activated citrate transporter (MATE) mRNA, complete cds.


27/08/2014

KJ872515; SV 1; circular; genomic DNA; STD; PLN; 153533 BP.
KJ872515;
Brassica napus strain DH366 chloroplast, complete genome. FT                   WLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPI


25/08/2014

KJ866947; SV 1; linear; genomic DNA; STD; PLN; 5986 BP.
KJ866947;
Brassica rapa subsp. pekinensis cultivar 06-247 phytochrome B (PHYB) gene, PHYB1 allele, promoter region and complete cds. FT                   HGEVVAESRREDLEPYIGLHYPATDIPQASRFLFKQNRVRMIVDCHATPVLVVQDDRLT

KJ866948; SV 1; linear; genomic DNA; STD; PLN; 5528 BP.
KJ866948;
Brassica rapa subsp. pekinensis cultivar He102 phytochrome B (PHYB) gene, PHYB2 allele, promoter region and complete cds.


22/08/2014

KJ865544; SV 1; linear; mRNA; STD; PLN; 1335 BP.
KJ865544;
Brassica napus isolate Fna_21209 GDP dissociation inhibitor (GDI1) mRNA, complete cds.

KJ865545; SV 1; linear; mRNA; STD; PLN; 1335 BP.
KJ865545;
Brassica napus isolate Fna_39123 GDP dissociation inhibitor (GDI1) mRNA, complete cds.


20/08/2014

KJ820998; SV 1; linear; mRNA; STD; PLN; 996 BP.
KJ820998;
Brassica napus polygalacturonase inhibiting protein 2-1 mRNA, complete cds.


19/08/2014

KJ775737; SV 1; linear; genomic DNA; STD; PLN; 1890 BP.
KJ775737;
UNVERIFIED: Brassica napus cultivar GSL1 non-expressor of pathogenesis related protein-like gene, partial sequence.

KJ775739; SV 1; linear; genomic DNA; STD; PLN; 2014 BP.
KJ775739;
UNVERIFIED: Brassica oleracea cultivar PUSA ageti non-expressor of pathogenesis related protein-like gene, partial sequence.

KJ775740; SV 1; linear; genomic DNA; STD; PLN; 1677 BP.
KJ775740;
UNVERIFIED: Brassica rapa cultivar PT 303 non-expressor of pathogenesis related protein-like gene, partial sequence.


02/08/2014

KF286549; SV 1; linear; mRNA; STD; PLN; 1854 BP.
KF286549;
Brassica rapa subsp. pekinensis LKP2 mRNA, complete cds.

KF286550; SV 1; linear; mRNA; STD; PLN; 1908 BP.
KF286550;
Brassica rapa subsp. pekinensis LKP2b mRNA, complete cds.


31/07/2014

KM062522; SV 1; linear; mRNA; STD; PLN; 330 BP.
KM062522;
Brassica napus cultivar Zhongshuang 11 lipid transfer protein (LTP2) mRNA, complete cds.


28/07/2014

JQ638491; SV 1; linear; mRNA; STD; PLN; 3242 BP.
JQ638491;
Brassica rapa retinoblastoma-related protein (A.RBR.a) mRNA, complete cds, alternatively spliced.

JQ638492; SV 1; linear; mRNA; STD; PLN; 3293 BP.
JQ638492;
Brassica rapa retinoblastoma-related protein (A.RBR.b) mRNA, complete cds.

JQ638499; SV 1; linear; mRNA; STD; PLN; 3285 BP.
JQ638499;
Brassica rapa retinoblastoma-related protein (A.RBR.a l) mRNA, complete cds, alternatively spliced.

KM027339; SV 1; linear; genomic DNA; STD; PLN; 90622 BP.
KM027339;
Brassica oleracea var. alboglabra clone 340 genomic sequence.


26/07/2014

KF444045; SV 1; linear; genomic DNA; STD; PLN; 4235 BP.
KF444045;
Brassica napus clone a delta1-pyrroline-5-carboxylate synthetase 1 (P5CS1) gene, complete cds.

KF444046; SV 1; linear; genomic DNA; STD; PLN; 4446 BP.
KF444046;
Brassica napus clone b delta1-pyrroline-5-carboxylate synthetase 1 (P5CS1) gene, complete cds.

KF444047; SV 1; linear; genomic DNA; STD; PLN; 3890 BP.
KF444047;
Brassica napus clone c delta1-pyrroline-5-carboxylate synthetase 1 (P5CS1) gene, complete cds.

KF444048; SV 1; linear; genomic DNA; STD; PLN; 4106 BP.
KF444048;
Brassica napus clone d delta1-pyrroline-5-carboxylate synthetase 1 (P5CS1) gene, complete cds.

KF444049; SV 1; linear; genomic DNA; STD; PLN; 4572 BP.
KF444049;
Brassica napus clone e delta1-pyrroline-5-carboxylate synthetase 1 (P5CS1) gene, complete cds.

KF444050; SV 1; linear; genomic DNA; STD; PLN; 3898 BP.
KF444050;
Brassica napus clone f delta1-pyrroline-5-carboxylate synthetase 1 (P5CS1) gene, complete cds.


25/07/2014

KF444894; SV 1; linear; genomic DNA; STD; PLN; 1566 BP.
KF444894;
Brassica napus MAP kinase 10 (MAPK10) gene, promoter region.

KF444895; SV 1; linear; genomic DNA; STD; PLN; 1526 BP.
KF444895;
Brassica napus bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily gene, promoter region.

KF444896; SV 1; linear; genomic DNA; STD; PLN; 1475 BP.
KF444896;
Brassica napus YUCCA-like putative flavin monooxygenase 5 (YUC5) gene, promoter region.

KF444897; SV 1; linear; genomic DNA; STD; PLN; 1373 BP.
KF444897;
Brassica napus hypothetical protein (DUF640) gene, promoter region.

KF444898; SV 1; linear; genomic DNA; STD; PLN; 1468 BP.
KF444898;
Brassica napus microtubule-associated protein 65-8 (MAP65-8) gene, promoter region.


24/07/2014

KM025246; SV 1; linear; genomic DNA; STD; PLN; 1399 BP.
KM025246;
Brassica napus ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, partial cds; chloroplast.

KM025247; SV 1; linear; genomic DNA; STD; PLN; 1399 BP.
KM025247;
Brassica oleracea ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, partial cds; chloroplast.

KM025248; SV 1; linear; genomic DNA; STD; PLN; 1399 BP.
KM025248;
Brassica rapa ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit (rbcL) gene, partial cds; chloroplast.

KM025280; SV 1; linear; genomic DNA; STD; PLN; 826 BP.
KM025280;
Brassica rapa clone B.rapaA1 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025281; SV 1; linear; genomic DNA; STD; PLN; 826 BP.
KM025281;
Brassica napus clone B.napusBnA1 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025282; SV 1; linear; genomic DNA; STD; PLN; 790 BP.
KM025282;
Brassica rapa clone B.rapaA2a chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025283; SV 1; linear; genomic DNA; STD; PLN; 792 BP.
KM025283;
Brassica napus clone B.napusBnA2a chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025284; SV 1; linear; genomic DNA; STD; PLN; 793 BP.
KM025284;
Brassica rapa clone B.rapaA2b chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025285; SV 1; linear; genomic DNA; STD; PLN; 793 BP.
KM025285;
Brassica napus clone B.napusBnA2b chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025286; SV 1; linear; genomic DNA; STD; PLN; 806 BP.
KM025286;
Brassica rapa clone B.rapaA3 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025287; SV 1; linear; genomic DNA; STD; PLN; 802 BP.
KM025287;
Brassica napus clone B.napusBnA3 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025288; SV 1; linear; genomic DNA; STD; PLN; 805 BP.
KM025288;
Brassica rapa clone B.rapaA4 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025289; SV 1; linear; genomic DNA; STD; PLN; 805 BP.
KM025289;
Brassica napus clone B.napusBnA4 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025290; SV 1; linear; genomic DNA; STD; PLN; 780 BP.
KM025290;
Brassica rapa clone B.rapaA5 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025291; SV 1; linear; genomic DNA; STD; PLN; 780 BP.
KM025291;
Brassica napus clone B.napusBnA5a chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025292; SV 1; linear; genomic DNA; STD; PLN; 780 BP.
KM025292;
Brassica napus clone B.napusBnA5b chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025293; SV 1; linear; genomic DNA; STD; PLN; 796 BP.
KM025293;
Brassica rapa clone B.rapaA6 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025294; SV 1; linear; genomic DNA; STD; PLN; 796 BP.
KM025294;
Brassica napus clone B.napusBnA6 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025295; SV 1; linear; genomic DNA; STD; PLN; 826 BP.
KM025295;
Brassica oleracea clone B.oleraceaC1 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025296; SV 1; linear; genomic DNA; STD; PLN; 826 BP.
KM025296;
Brassica napus clone B.napusBnC1 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025297; SV 1; linear; genomic DNA; STD; PLN; 826 BP.
KM025297;
Brassica oleracea clone B.oleraceaC2 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025298; SV 1; linear; genomic DNA; STD; PLN; 826 BP.
KM025298;
Brassica napus clone B.napusBnC2 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025299; SV 1; linear; genomic DNA; STD; PLN; 824 BP.
KM025299;
Brassica oleracea clone B.oleraceaC3 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025300; SV 1; linear; genomic DNA; STD; PLN; 824 BP.
KM025300;
Brassica napus clone B.napusBnC3 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025301; SV 1; linear; genomic DNA; STD; PLN; 801 BP.
KM025301;
Brassica oleracea clone B.oleraceaC4 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025302; SV 1; linear; genomic DNA; STD; PLN; 802 BP.
KM025302;
Brassica napus clone B.napusBnC4 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025303; SV 1; linear; genomic DNA; STD; PLN; 801 BP.
KM025303;
Brassica oleracea clone B.oleraceaC5 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025304; SV 1; linear; genomic DNA; STD; PLN; 801 BP.
KM025304;
Brassica napus clone B.napusBnC5a chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025305; SV 1; linear; genomic DNA; STD; PLN; 801 BP.
KM025305;
Brassica napus clone B.napusBnC5b chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025306; SV 1; linear; genomic DNA; STD; PLN; 799 BP.
KM025306;
Brassica oleracea clone B.oleraceaC6 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025307; SV 1; linear; genomic DNA; STD; PLN; 799 BP.
KM025307;
Brassica napus clone B.napusBnC6a chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025308; SV 1; linear; genomic DNA; STD; PLN; 796 BP.
KM025308;
Brassica napus clone B.napusBnC6b chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025309; SV 1; linear; genomic DNA; STD; PLN; 780 BP.
KM025309;
Brassica oleracea clone B.oleraceaC7 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025310; SV 1; linear; genomic DNA; STD; PLN; 780 BP.
KM025310;
Brassica napus clone B.napusBnC7 chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025311; SV 1; linear; genomic DNA; STD; PLN; 794 BP.
KM025311;
Brassica oleracea clone B.oleraceaC8a chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025312; SV 1; linear; genomic DNA; STD; PLN; 794 BP.
KM025312;
Brassica napus clone B.napusBnC8a chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025313; SV 1; linear; genomic DNA; STD; PLN; 789 BP.
KM025313;
Brassica oleracea clone B.oleraceaC8b chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.

KM025314; SV 1; linear; genomic DNA; STD; PLN; 789 BP.
KM025314;
Brassica napus clone B.napusBnC8b chloroplast ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit (rbcS) gene, partial cds; nuclear gene for chloroplast product.


18/07/2014

KJ755984; SV 1; linear; mRNA; STD; PLN; 2430 BP.
KJ755984;
Brassica napus cultivar Westar phospholipase D1 mRNA, partial cds.

KJ755985; SV 1; linear; mRNA; STD; PLN; 852 BP.
KJ755985;
Brassica napus cultivar Westar glyoxalase I mRNA, complete cds.


16/07/2014

KJ734988; SV 1; linear; mRNA; STD; PLN; 1222 BP.
KJ734988;
Brassica napus glycerol-3-phosphate dehydrogenase-like protein mRNA, complete cds.


13/07/2014

LK937699; SV 1; linear; mRNA; STD; PLN; 833 BP.
LK937699;
Brassica napus partial mRNA for Serine/threonine protein kinase (SRK2D gene), cultivar SLM046


07/07/2014

KJ701579; SV 1; linear; mRNA; STD; PLN; 1976 BP.
KJ701579;
Brassica napus FCA-5 mRNA, partial cds, alternatively spliced.


02/07/2014

KC206501; SV 1; linear; genomic DNA; STD; PLN; 6144 BP.
KC206501;
Brassica napus cultivar Darmor-bzh cleistogamy A (CLG1A) gene, complete cds.

KC206502; SV 1; linear; genomic DNA; STD; PLN; 6144 BP.
KC206502;
Mutant Brassica napus cultivar Darmor-bzh cleistogamy A (clg1A) gene, clg1A-1D allele, complete cds.

KC206503; SV 1; linear; genomic DNA; STD; PLN; 6585 BP.
KC206503;
Brassica napus cultivar Darmor-bzh cleistogamy C (CLG1C) gene, complete cds.

KC206504; SV 1; linear; genomic DNA; STD; PLN; 6358 BP.
KC206504;
Brassica napus cultivar Darmor-bzh zinc finger protein 2A (Rzfp2A) gene, complete cds.

KC206505; SV 1; linear; genomic DNA; STD; PLN; 5560 BP.
KC206505;
Brassica napus cultivar Darmor-bzh zinc finger protein 2C (Rzfp2C) gene, complete cds.

KC206506; SV 1; linear; genomic DNA; STD; PLN; 5443 BP.
KC206506;
Brassica napus cultivar Darmor-bzh zinc finger protein 3A (Rzfp3A) gene, complete cds.

KC206507; SV 1; linear; genomic DNA; STD; PLN; 5434 BP.
KC206507;
Brassica napus cultivar Darmor-bzh zinc finger protein 3C (Rzfp3C) gene, complete cds.

KC206508; SV 1; linear; genomic DNA; STD; PLN; 5369 BP.
KC206508;
Brassica napus cultivar Darmor-bzh zinc finger protein 2Cb (Rzfp2Cb) gene, complete cds.

KC206509; SV 1; linear; genomic DNA; STD; PLN; 237660 BP.
KC206509;
Brassica napus clone BAC CZ7N2, complete sequence. FT                   DAVVEYVPDSQDSCEVEMKEEDDDELILFTGASKNIHKTREIKSASALIEKGVHKSKSR FT                   LVKISHKCMMNELQRFPVLRKRMDEVIGDFLREGLEPSEAMIGDIIDMEMDYINTSHPN FT                   CGGWTNEKHNLYLDSLENSFVKQLYSLLGVGGETQRLSRTRGVQSNSHKLTDQFTVLQN

KC206510; SV 1; linear; genomic DNA; STD; PLN; 93183 BP.
KC206510;
Mutant Brassica napus clone Clg_H1B_P13a_3_J1, complete sequence. FT                   CGGWTNEKHNLYLDSLENSFVKQLYSLLGVGGETQRLSRTRGVQSNSHKLTDQFTVLQN

KF218590; SV 1; linear; mRNA; STD; PLN; 370 BP.
KF218590;
Brassica oleracea var. viridis elongation factor 1 alpha (EF1a) mRNA, partial cds.

KF218591; SV 1; linear; mRNA; STD; PLN; 386 BP.
KF218591;
Brassica oleracea var. viridis actin 2 (ACT2) mRNA, partial cds.

KF218592; SV 1; linear; genomic DNA; STD; PLN; 444 BP.
KF218592;
Brassica oleracea var. viridis 5.8S ribosomal RNA gene, partial sequence; internal transcribed spacer 2, complete sequence; and 25S ribosomal RNA gene, partial sequence.

KF218593; SV 1; linear; mRNA; STD; PLN; 359 BP.
KF218593;
Brassica oleracea var. viridis ubiquitin (UBQ2) mRNA, partial cds.

KF218594; SV 1; linear; mRNA; STD; PLN; 398 BP.
KF218594;
Brassica oleracea var. viridis glyceraldehyde-3-phosphate dehydrogenase (ALDH1) mRNA, partial cds.

KF218595; SV 1; linear; mRNA; STD; PLN; 377 BP.
KF218595;
Brassica oleracea var. viridis TATA-box binding protein (TPB1) mRNA, partial cds.

KF218596; SV 1; linear; mRNA; STD; PLN; 294 BP.
KF218596;
Brassica oleracea var. viridis SAND family protein mRNA, partial cds.

KF218597; SV 1; linear; mRNA; STD; PLN; 345 BP.
KF218597;
Brassica oleracea var. viridis tubulin beta 6 (TUB6) mRNA, partial cds.

KF218598; SV 1; linear; mRNA; STD; PLN; 311 BP.
KF218598;
Brassica oleracea var. viridis dehydration-responsive element-binding protein 2A (DREB2A) mRNA, partial cds.

KF218599; SV 1; linear; mRNA; STD; PLN; 335 BP.
KF218599;
Brassica oleracea var. viridis early light inducible protein (ELIP1) mRNA, partial cds.

KJ660984; SV 1; linear; genomic DNA; STD; PLN; 521 BP.
KJ660984;
Brassica rapa subsp. chinensis arabinogalactan protein (MF18) gene, complete cds.

KJ686594; SV 1; linear; genomic DNA; STD; PLN; 1059 BP.
KJ686594;
Brassica rapa subsp. pekinensis LIM domain-containing protein (LIM7) gene, complete cds.

KJ686595; SV 1; linear; genomic DNA; STD; PLN; 1137 BP.
KJ686595;
Brassica rapa subsp. pekinensis LIM domain-containing protein (LIM9) gene, complete cds.


30/06/2014

JQ844163; SV 1; linear; mRNA; STD; PLN; 791 BP.
JQ844163; AY065838;
Brassica oleracea var. italica cysteine protease inhibitor (CPI-1) mRNA, complete cds.

JX416473; SV 1; linear; genomic DNA; STD; PLN; 8349 BP.
JX416473;
Brassica napus cultivar Darmor-bzh erecta leucine-rich-repeat receptor-like kinase (ER_gA) gene, complete cds.

JX416474; SV 1; linear; genomic DNA; STD; PLN; 8296 BP.
JX416474;
Brassica napus cultivar Darmor-bzh erecta leucine-rich-repeat receptor-like kinase (ER_gC) gene, complete cds.


26/06/2014

JQ844163; SV 1; linear; mRNA; STD; PLN; 791 BP.
JQ844163;
Brassica oleracea var. italica cysteine protease inhibitor (CPI-1) mRNA, complete cds.


20/06/2014

KF612342; SV 1; linear; mRNA; STD; PLN; 855 BP.
KF612342;
Brassica napus clone BnA03N4-A827 putative xyloglucan endotransglucosylase/hydrolase protein (XTH1) mRNA, complete cds.

KJ820683; SV 1; circular; genomic DNA; STD; PLN; 219962 BP.
KJ820683;
Brassica oleracea var. botrytis mitochondrion, complete genome.


17/06/2014

KF612342; SV 1; linear; mRNA; STD; PLN; 855 BP.
KF612342;
Brassica napus clone BnA03N4-A827 putative xyloglucan endotransglucosylase/hydrolase protein (XTH1) mRNA, complete cds.


13/06/2014

KJ747104; SV 1; linear; genomic DNA; STD; PLN; 1138 BP.
KJ747104;
Brassica rapa protein farnesyl transferase beta subunit (ERA) gene, partial cds; chloroplast. FT                   DSDEDSGNGHQVHHTSTYIDRRIQPVFDSLGLQRYVLLCSKVADGGFRDS"

KJ747105; SV 1; linear; genomic DNA; STD; PLN; 875 BP.
KJ747105;
Brassica rapa hexokinase (HXK) gene, partial cds; chloroplast.

KJ747106; SV 1; linear; genomic DNA; STD; PLN; 542 BP.
KJ747106;
Brassica rapa chlorophyll a-b binding protein 1C (CAB) gene, partial cds; chloroplast.

KJ747107; SV 1; linear; genomic DNA; STD; PLN; 467 BP.
KJ747107;
Brassica rapa phospholipase D2 (PLD) gene, partial cds; chloroplast.

KJ747108; SV 1; linear; genomic DNA; STD; PLN; 557 BP.
KJ747108;
Brassica rapa ribulose bisphosphate carboxylase small chain (RBCS) gene, partial cds; chloroplast.

KC203458; SV 1; linear; genomic DNA; STD; PLN; 1189 BP.
KC203458;
Brassica rapa subsp. pekinensis cultivar He102 eukaryotic translation initiation factor 4E.a gene, complete cds.

KC203459; SV 1; linear; genomic DNA; STD; PLN; 1188 BP.
KC203459;
Brassica rapa subsp. pekinensis cultivar Guan291 mutant eukaryotic translation initiation factor 4E.a gene, complete cds.

KC203460; SV 1; linear; genomic DNA; STD; PLN; 1152 BP.
KC203460;
Brassica rapa subsp. pekinensis cultivar 06-247 mutant eukaryotic translation initiation factor 4E.a gene, complete cds.

KC203461; SV 1; linear; genomic DNA; STD; PLN; 1154 BP.
KC203461;
Brassica rapa subsp. pekinensis cultivar 322 mutant eukaryotic translation initiation factor 4E.a gene, complete cds.

KC203462; SV 1; linear; genomic DNA; STD; PLN; 1155 BP.
KC203462;
Brassica rapa subsp. pekinensis cultivar 8407 eukaryotic translation initiation factor 4E.a gene, complete cds.

KC431004; SV 1; linear; genomic DNA; STD; PLN; 1563 BP.
KC431004;
Brassica rapa subsp. pekinensis haplotype 1-1 translation initiation factor eIF4E.c1 (eIF4E.c) gene, complete cds.

KC431005; SV 1; linear; genomic DNA; STD; PLN; 1568 BP.
KC431005;
Brassica rapa subsp. pekinensis haplotype 2-1 translation initiation factor eIF4E.c2 (eIF4E.c) gene, complete cds.

KC431006; SV 1; linear; genomic DNA; STD; PLN; 1568 BP.
KC431006;
Brassica rapa subsp. pekinensis haplotype 2-2 translation initiation factor eIF4E.c3 (eIF4E.c) gene, complete cds.

KC431007; SV 1; linear; genomic DNA; STD; PLN; 1563 BP.
KC431007;
Brassica rapa subsp. pekinensis haplotype 4-1 translation initiation factor eIF4E.c5 (eIF4E.c) gene, complete cds.

KC431008; SV 1; linear; genomic DNA; STD; PLN; 1568 BP.
KC431008;
Brassica rapa subsp. pekinensis haplotype 4-2 translation initiation factor eIF4E.c6 (eIF4E.c) gene, complete cds.

KJ608141; SV 1; linear; genomic DNA; STD; TGN; 840 BP.
KJ608141;
Brassica napus transgenic line OXY235 promoter region.


06/06/2014

KJ576888; SV 1; linear; mRNA; STD; PLN; 1509 BP.
KJ576888;
Brassica napus diacylglycerol acyltransferase 1 (DGAT1-1) mRNA, complete cds.

KJ576889; SV 1; linear; mRNA; STD; PLN; 1533 BP.
KJ576889;
Brassica napus diacylglycerol acyltransferase 1 (DGAT1-2) mRNA, complete cds.

KJ576890; SV 1; linear; mRNA; STD; PLN; 1515 BP.
KJ576890;
Brassica napus diacylglycerol acyltransferase 1 (DGAT1-3) mRNA, complete cds.

KJ576891; SV 1; linear; mRNA; STD; PLN; 1506 BP.
KJ576891;
Brassica napus diacylglycerol acyltransferase 1 (DGAT1-4) mRNA, complete cds.


04/06/2014

KF169730; SV 1; linear; mRNA; STD; PLN; 1392 BP.
KF169730;
Brassica napus CBL-interacting protein kinase 2 (CIPK2.1) mRNA, complete cds.

KF169731; SV 1; linear; mRNA; STD; PLN; 1461 BP.
KF169731;
Brassica napus CBL-interacting protein kinase 13 (CIPK13.1) mRNA, complete cds.

KF169732; SV 1; linear; mRNA; STD; PLN; 1551 BP.
KF169732;
Brassica napus CBL-interacting protein kinase 18 (CIPK18.1) mRNA, complete cds.

KF169733; SV 1; linear; mRNA; STD; PLN; 1248 BP.
KF169733;
Brassica napus CBL-interacting protein kinase 21 (CIPK21.1) mRNA, complete cds.

KF169734; SV 1; linear; mRNA; STD; PLN; 1284 BP.
KF169734;
Brassica napus CBL-interacting protein kinase 22 (CIPK22.1) mRNA, complete cds.

KF612589; SV 1; linear; mRNA; STD; PLN; 1506 BP.
KF612589;
Brassica rapa cultivar Black Behi CYP81F4-1 mRNA, complete cds.

KF612590; SV 1; linear; mRNA; STD; PLN; 1506 BP.
KF612590;
Brassica rapa cultivar Black Behi CYP81F4-2 mRNA, complete cds.

KJ607174; SV 1; linear; genomic DNA; STD; PLN; 734 BP.
KJ607174;
Brassica oleracea var. viridis 18S ribosomal RNA gene, partial sequence.


31/05/2014

KC190095; SV 1; linear; mRNA; STD; PLN; 1104 BP.
KC190095;
Brassica napus mitogen-activated protein kinase kinase kinase 17.1 (MAPKKK17.1) mRNA, complete cds.

KC190096; SV 1; linear; mRNA; STD; PLN; 1014 BP.
KC190096;
Brassica napus mitogen-activated protein kinase kinase kinase 18.1 (MAPKKK18.1) mRNA, complete cds.

KC190097; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KC190097;
Brassica napus mitogen-activated protein kinase kinase kinase 19.1 (MAPKKK19.1) mRNA, complete cds.

KC190098; SV 1; linear; mRNA; STD; PLN; 1029 BP.
KC190098;
Brassica napus mitogen-activated protein kinase kinase kinase 20.1 (MAPKKK20.1) mRNA, complete cds.

KC190099; SV 1; linear; mRNA; STD; PLN; 1686 BP.
KC190099;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK2.1 (ZIK2.1) mRNA, complete cds. FT                   NGMAKKVAFPFGIMNDTSVDVAMEMVKELEITDWDPVEIAEMIDGEISSLVPGWRYEEG

KC190100; SV 1; linear; mRNA; STD; PLN; 1701 BP.
KC190100;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK3.1 (ZIK3.1) mRNA, complete cds. FT                   YEGIEVAWNQVKLRNFTRNPEELEKFFREIHLLKTLNHQNIMKFYTSWVDTNNLAINFV

KC190101; SV 1; linear; mRNA; STD; PLN; 2037 BP.
KC190101;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK4.1 (ZIK4.1) mRNA, partial cds.

KC190102; SV 1; linear; mRNA; STD; PLN; 936 BP.
KC190102;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK8.1 (ZIK8.1) mRNA, complete cds.

KC190103; SV 1; linear; mRNA; STD; PLN; 1317 BP.
KC190103;
Brassica napus mitogen-activated protein kinase kinase kinase Raf17.1 (Raf17.1) mRNA, complete cds.

KC190104; SV 1; linear; mRNA; STD; PLN; 1230 BP.
KC190104;
Brassica napus mitogen-activated protein kinase kinase kinase Raf28.1 (Raf28.1) mRNA, complete cds.

KC190105; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KC190105;
Brassica napus mitogen-activated protein kinase kinase kinase Raf29.1 (Raf29.1) mRNA, complete cds.

KC190106; SV 1; linear; mRNA; STD; PLN; 1704 BP.
KC190106;
Brassica napus mitogen-activated protein kinase kinase kinase Raf30.1 (Raf30.1) mRNA, complete cds.

KC190107; SV 1; linear; mRNA; STD; PLN; 1059 BP.
KC190107;
Brassica napus mitogen-activated protein kinase kinase kinase Raf34.1 (Raf34.1) mRNA, complete cds.

KC190108; SV 1; linear; mRNA; STD; PLN; 3189 BP.
KC190108;
Brassica napus mitogen-activated protein kinase kinase kinase Raf35.1 (Raf35.1) mRNA, complete cds.

KC190109; SV 1; linear; mRNA; STD; PLN; 1530 BP.
KC190109;
Brassica napus mitogen-activated protein kinase kinase kinase Raf36.1 (Raf36.1) mRNA, partial cds. FT                   NGCLGARLEKQFTKEVTLLSRLSHPNVIKFVGAYKDPPSYCVLTEYLPEGSLRSYLHKP

KC190110; SV 1; linear; mRNA; STD; PLN; 1137 BP.
KC190110;
Brassica napus mitogen-activated protein kinase kinase kinase Raf39.1 (Raf39.1) mRNA, complete cds.

KF129395; SV 1; linear; mRNA; STD; PLN; 2412 BP.
KF129395;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase CTR1 (CTR1) mRNA, complete cds.

KF129396; SV 1; linear; mRNA; STD; PLN; 1641 BP.
KF129396;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf21 (Raf21) mRNA, complete cds.

KF129397; SV 1; linear; mRNA; STD; PLN; 1227 BP.
KF129397;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf22 (Raf22) mRNA, complete cds.

KF129398; SV 1; linear; mRNA; STD; PLN; 1431 BP.
KF129398;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf23 (Raf23) mRNA, complete cds.

KF129399; SV 1; linear; mRNA; STD; PLN; 1380 BP.
KF129399;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf27 (Raf27) mRNA, complete cds.

KF129400; SV 1; linear; mRNA; STD; PLN; 1155 BP.
KF129400;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf33 (Raf33) mRNA, complete cds.

KF129401; SV 1; linear; mRNA; STD; PLN; 1197 BP.
KF129401;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf37 (Raf37) mRNA, complete cds.

KF129402; SV 1; linear; mRNA; STD; PLN; 1071 BP.
KF129402;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf41 (Raf41) mRNA, complete cds.

KF129403; SV 1; linear; mRNA; STD; PLN; 1377 BP.
KF129403;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf46 (Raf46) mRNA, complete cds.

KF129404; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KF129404;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK5 (ZIK5) mRNA, complete cds.

KF129405; SV 1; linear; mRNA; STD; PLN; 1665 BP.
KF129405;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK6 (ZIK6) mRNA, complete cds. FT                   VDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFNSWVDEKNKTINMI

KF129406; SV 1; linear; mRNA; STD; PLN; 1428 BP.
KF129406;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK9 (ZIK9) mRNA, complete cds. FT                   YEGIEVAWNQVKLYDFLQSPQELERLYCEIHLLKTLKHKSIMKFYTSWVDTDNRNINFI


24/05/2014

JZ585519; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ585519;
Pm19 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm19 5' similar to Photosystem II 10kDa polypeptide, mRNA sequence.

JZ585520; SV 1; linear; mRNA; EST; PLN; 420 BP.
JZ585520;
Pm099 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm099 5' similar to WRKY transcription protein, mRNA sequence.

JZ585521; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ585521;
Pm062 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm062 5' similar to Cytochrome 450, mRNA sequence.

JZ585522; SV 1; linear; mRNA; EST; PLN; 310 BP.
JZ585522;
Pm024 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm024 5' similar to ABC transporter protein, mRNA sequence.

JZ585523; SV 1; linear; mRNA; EST; PLN; 361 BP.
JZ585523;
Pm064 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm064 5' similar to superoxide dismutase, mRNA sequence.

JZ585524; SV 1; linear; mRNA; EST; PLN; 516 BP.
JZ585524;
Ga10 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga10 5' similar to transcription factor, mRNA sequence.

JZ585525; SV 1; linear; mRNA; EST; PLN; 390 BP.
JZ585525;
Ga8 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga8 5' similar to Jasmonate O-methyltransferase, mRNA sequence.

JZ585526; SV 1; linear; mRNA; EST; PLN; 510 BP.
JZ585526;
Ga89 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga89 5' similar to S-adenosylmethionine, mRNA sequence.

JZ585527; SV 1; linear; mRNA; EST; PLN; 330 BP.
JZ585527;
Ga5 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga5 5' similar to Thionin, mRNA sequence.

JZ585528; SV 1; linear; mRNA; EST; PLN; 360 BP.
JZ585528;
Ga21 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga21 5' similar to Glutathione-S-transferase, mRNA sequence.

JZ585529; SV 1; linear; mRNA; EST; PLN; 414 BP.
JZ585529;
Ga33 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga33 5', mRNA sequence.

JZ585530; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ585530;
Ga91 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga91 5' similar to Histone, mRNA sequence.

JZ585531; SV 1; linear; mRNA; EST; PLN; 399 BP.
JZ585531;
Ga122 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga122 5' similar to Lipase, mRNA sequence.

JZ585532; SV 1; linear; mRNA; EST; PLN; 480 BP.
JZ585532;
Ga1 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga1 5' similar to disease resistance protein, mRNA sequence.

JZ585533; SV 1; linear; mRNA; EST; PLN; 360 BP.
JZ585533;
Ga6 Brassica oleracea var. capitata - Pfu SSH Library Brassica oleracea var. capitata cDNA clone Ga6 5' similar to disease resistance protein, mRNA sequence.


21/05/2014

KJ511239; SV 1; linear; mRNA; STD; PLN; 1344 BP.
KJ511239;
Brassica napus cultivar Westar inositol 1,3,4,5,6-pentakisphosphate 2-kinase (IPK1) mRNA, complete cds.

KJ511240; SV 1; linear; mRNA; STD; PLN; 849 BP.
KJ511240;
Brassica napus cultivar Westar inositol polyphosphate 6-/3-/5-kinase (IPK2a) mRNA, complete cds.

KJ511241; SV 1; linear; mRNA; STD; PLN; 2175 BP.
KJ511241;
Brassica napus cultivar Westar diacylglycerol kinase (DAGK1) mRNA, complete cds.


17/05/2014

JN806156; SV 1; linear; mRNA; STD; PLN; 1254 BP.
JN806156;
Brassica napus PHR1 (PHR1) mRNA, complete cds.

JZ585251; SV 1; linear; mRNA; EST; PLN; 540 BP.
JZ585251;
Pm1 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm1 5', mRNA sequence.

JZ585252; SV 1; linear; mRNA; EST; PLN; 405 BP.
JZ585252;
Pm9 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm9 5' similar to 60S ribosomal protein, mRNA sequence.

JZ585253; SV 1; linear; mRNA; EST; PLN; 246 BP.
JZ585253;
Pm25 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm25 5' similar to 40S ribosomal protein, mRNA sequence.

JZ585254; SV 1; linear; mRNA; EST; PLN; 464 BP.
JZ585254;
Pm108 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm108 5' similar to Disease resistance protein, mRNA sequence.

JZ585255; SV 1; linear; mRNA; EST; PLN; 486 BP.
JZ585255;
Pm214 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm214 5' similar to Disease resistance protein, mRNA sequence.

JZ585256; SV 1; linear; mRNA; EST; PLN; 261 BP.
JZ585256;
Pm6 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm6 5' similar to Resistance gene protein, mRNA sequence.

JZ585257; SV 1; linear; mRNA; EST; PLN; 510 BP.
JZ585257;
Pm111 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm111 5', mRNA sequence.

JZ585258; SV 1; linear; mRNA; EST; PLN; 507 BP.
JZ585258;
Pm204 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm204 5' similar to Glutathione peroxidase protein, mRNA sequence.

JZ585259; SV 1; linear; mRNA; EST; PLN; 420 BP.
JZ585259;
Pm046 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm46 5' similar to DNA polymerase subunit protein, mRNA sequence.

JZ585260; SV 1; linear; mRNA; EST; PLN; 543 BP.
JZ585260;
Pm57 Brassica oleracea var. capitata SSH Library Brassica oleracea var. capitata cDNA clone Pm57 5' similar to Ribulose phosphate protein, mRNA sequence.


16/05/2014

GR301387; SV 1; linear; mRNA; EST; PLN; 236 BP.
GR301387;
BoBF1 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301388; SV 1; linear; mRNA; EST; PLN; 143 BP.
GR301388;
BoBF2 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301389; SV 1; linear; mRNA; EST; PLN; 188 BP.
GR301389;
BoBF3 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301390; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301390;
BoBF4 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301391; SV 1; linear; mRNA; EST; PLN; 135 BP.
GR301391;
BoBF5 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301392; SV 1; linear; mRNA; EST; PLN; 91 BP.
GR301392;
BoBF6 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301393; SV 1; linear; mRNA; EST; PLN; 84 BP.
GR301393;
BoBF7 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301394; SV 1; linear; mRNA; EST; PLN; 213 BP.
GR301394;
BoBF8 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301395; SV 1; linear; mRNA; EST; PLN; 311 BP.
GR301395;
BoBF9 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301396; SV 1; linear; mRNA; EST; PLN; 310 BP.
GR301396;
BoBF10 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301397; SV 1; linear; mRNA; EST; PLN; 177 BP.
GR301397;
BoBF11 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301398; SV 1; linear; mRNA; EST; PLN; 176 BP.
GR301398;
BoBF12 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301399; SV 1; linear; mRNA; EST; PLN; 186 BP.
GR301399;
BoBF13 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301400; SV 1; linear; mRNA; EST; PLN; 128 BP.
GR301400;
BoBF14 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301401; SV 1; linear; mRNA; EST; PLN; 127 BP.
GR301401;
BoBF15 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301402; SV 1; linear; mRNA; EST; PLN; 181 BP.
GR301402;
BoBF16 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301403; SV 1; linear; mRNA; EST; PLN; 101 BP.
GR301403;
BoBF17 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301404; SV 1; linear; mRNA; EST; PLN; 105 BP.
GR301404;
BoBF18 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301405; SV 1; linear; mRNA; EST; PLN; 98 BP.
GR301405;
BoBF19 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301406; SV 1; linear; mRNA; EST; PLN; 320 BP.
GR301406;
BoBF20 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301407; SV 1; linear; mRNA; EST; PLN; 109 BP.
GR301407;
BoBF21 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301408; SV 1; linear; mRNA; EST; PLN; 108 BP.
GR301408;
BoBF22 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301409; SV 1; linear; mRNA; EST; PLN; 99 BP.
GR301409;
BoBF23 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301410; SV 1; linear; mRNA; EST; PLN; 129 BP.
GR301410;
BoBF24 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301411; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301411;
BoBF25 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301412; SV 1; linear; mRNA; EST; PLN; 78 BP.
GR301412;
BoBF26 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301413; SV 1; linear; mRNA; EST; PLN; 236 BP.
GR301413;
BoCF1 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301414; SV 1; linear; mRNA; EST; PLN; 143 BP.
GR301414;
BoCF2 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301415; SV 1; linear; mRNA; EST; PLN; 188 BP.
GR301415;
BoCF3 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301416; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301416;
BoCF4 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301417; SV 1; linear; mRNA; EST; PLN; 135 BP.
GR301417;
BoCF5 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301418; SV 1; linear; mRNA; EST; PLN; 91 BP.
GR301418;
BoCF6 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301419; SV 1; linear; mRNA; EST; PLN; 84 BP.
GR301419;
BoCF7 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301420; SV 1; linear; mRNA; EST; PLN; 213 BP.
GR301420;
BoCF8 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301421; SV 1; linear; mRNA; EST; PLN; 177 BP.
GR301421;
BoCF11 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301422; SV 1; linear; mRNA; EST; PLN; 176 BP.
GR301422;
BoCF12 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301423; SV 1; linear; mRNA; EST; PLN; 186 BP.
GR301423;
BoCF13 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301424; SV 1; linear; mRNA; EST; PLN; 128 BP.
GR301424;
BoCF14 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301425; SV 1; linear; mRNA; EST; PLN; 127 BP.
GR301425;
BoCF15 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301426; SV 1; linear; mRNA; EST; PLN; 181 BP.
GR301426;
BoCF16 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301427; SV 1; linear; mRNA; EST; PLN; 101 BP.
GR301427;
BoCF17 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301428; SV 1; linear; mRNA; EST; PLN; 105 BP.
GR301428;
BoCF18 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301429; SV 1; linear; mRNA; EST; PLN; 98 BP.
GR301429;
BoCF19 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301430; SV 1; linear; mRNA; EST; PLN; 320 BP.
GR301430;
BoCF20 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301431; SV 1; linear; mRNA; EST; PLN; 109 BP.
GR301431;
BoCF21 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301432; SV 1; linear; mRNA; EST; PLN; 108 BP.
GR301432;
BoCF22 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301433; SV 1; linear; mRNA; EST; PLN; 99 BP.
GR301433;
BoCF23 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301434; SV 1; linear; mRNA; EST; PLN; 129 BP.
GR301434;
BoCF24 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301435; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301435;
BoCF25 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301436; SV 1; linear; mRNA; EST; PLN; 78 BP.
GR301436;
BoCF26 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

JN039346; SV 1; linear; mRNA; STD; PLN; 1417 BP.
JN039346;
Brassica rapa subsp. chinensis cultivar Suzhouqing mannose-6-phosphate isomerase-like protein (PMI2) mRNA, complete cds.

JX306690; SV 1; linear; mRNA; STD; PLN; 1279 BP.
JX306690;
Brassica napus clone MPIZp1022G0813Q glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306691; SV 1; linear; mRNA; STD; PLN; 950 BP.
JX306691;
Brassica napus clone MPIZp1022A1123Q glutamine synthetase 1 (GLN1.5) mRNA, partial cds.

JX306692; SV 1; linear; mRNA; STD; PLN; 1178 BP.
JX306692;
Brassica napus clone MPIZp1022C0924Q glutamine synthetase 1 (GLN1.4) mRNA, partial sequence.

JX306693; SV 1; linear; mRNA; STD; PLN; 1218 BP.
JX306693;
Brassica napus clone BN20.052B22 glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306694; SV 1; linear; mRNA; STD; PLN; 1257 BP.
JX306694;
Brassica napus clone BN40.043K19 glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306695; SV 1; linear; mRNA; STD; PLN; 1309 BP.
JX306695;
Brassica napus clone BN15.001A07 glutamine synthetase 1 (GLN1.4) mRNA, complete cds.

JX306696; SV 1; linear; mRNA; STD; PLN; 1104 BP.
JX306696;
Brassica napus clone BnGS_Gln1-4_61_G4_c1 glutamine synthetase 1 (GLN1.4) mRNA, complete sequence.

JX306697; SV 1; linear; mRNA; STD; PLN; 1103 BP.
JX306697;
Brassica napus clone BnGS_Gln1-4_61_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, complete cds.

JX306698; SV 1; linear; mRNA; STD; PLN; 784 BP.
JX306698;
Brassica napus clone BnGS1.63_G4_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306699; SV 1; linear; mRNA; STD; PLN; 784 BP.
JX306699;
Brassica napus clone BnGS1.63_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306700; SV 1; linear; mRNA; STD; PLN; 758 BP.
JX306700;
Brassica napus clone BnGS1.64_G4_c2 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306701; SV 1; linear; mRNA; STD; PLN; 758 BP.
JX306701;
Brassica napus clone BnGS1.64_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306702; SV 1; linear; mRNA; STD; PLN; 411 BP.
JX306702;
Brassica napus glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306703; SV 1; linear; mRNA; STD; PLN; 371 BP.
JX306703;
Brassica napus glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306704; SV 1; linear; genomic DNA; STD; PLN; 1685 BP.
JX306704;
Brassica napus clone BnGS1-63-T_ADNg3 glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306705; SV 1; linear; genomic DNA; STD; PLN; 1685 BP.
JX306705;
Brassica napus clone BnGS1-63-E_ADNg3 glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306706; SV 1; linear; genomic DNA; STD; PLN; 1699 BP.
JX306706;
Brassica napus clone BnGS1-64-E glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306707; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
JX306707;
Brassica napus clone BnGS1-63-T_2U-3L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306708; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
JX306708;
Brassica napus clone BnGS1-63-E_2U-3L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306709; SV 1; linear; genomic DNA; STD; PLN; 1181 BP.
JX306709;
Brassica napus clone BnGS1-64-E_2U-2L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306710; SV 1; linear; genomic DNA; STD; PLN; 1184 BP.
JX306710;
Brassica napus clone BnGS1-64-Dn_2U-2L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306711; SV 1; linear; genomic DNA; STD; PLN; 1610 BP.
JX306711;
Brassica napus clone BnGS1-64-Dn_5U-5L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX971618; SV 1; linear; mRNA; STD; PLN; 1016 BP.
JX971618;
Brassica oleracea cultivar Gold Acer male sterility related AT-hook DNA binding protein (MF2) mRNA, complete cds.

KC190095; SV 1; linear; mRNA; STD; PLN; 1104 BP.
KC190095;
Brassica napus mitogen-activated protein kinase kinase kinase 17.1 (MAPKKK17.1) mRNA, complete cds.

KC190096; SV 1; linear; mRNA; STD; PLN; 1014 BP.
KC190096;
Brassica napus mitogen-activated protein kinase kinase kinase 18.1 (MAPKKK18.1) mRNA, complete cds.

KC190097; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KC190097;
Brassica napus mitogen-activated protein kinase kinase kinase 19.1 (MAPKKK19.1) mRNA, complete cds.

KC190098; SV 1; linear; mRNA; STD; PLN; 1029 BP.
KC190098;
Brassica napus mitogen-activated protein kinase kinase kinase 20.1 (MAPKKK20.1) mRNA, complete cds.

KC190099; SV 1; linear; mRNA; STD; PLN; 1686 BP.
KC190099;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK2.1 (ZIK2.1) mRNA, complete cds. FT                   NGMAKKVAFPFGIMNDTSVDVAMEMVKELEITDWDPVEIAEMIDGEISSLVPGWRYEEG

KC190100; SV 1; linear; mRNA; STD; PLN; 1701 BP.
KC190100;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK3.1 (ZIK3.1) mRNA, complete cds. FT                   YEGIEVAWNQVKLRNFTRNPEELEKFFREIHLLKTLNHQNIMKFYTSWVDTNNLAINFV

KC190101; SV 1; linear; mRNA; STD; PLN; 2037 BP.
KC190101;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK4.1 (ZIK4.1) mRNA, partial cds.

KC190102; SV 1; linear; mRNA; STD; PLN; 936 BP.
KC190102;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK8.1 (ZIK8.1) mRNA, complete cds.

KC190103; SV 1; linear; mRNA; STD; PLN; 1317 BP.
KC190103;
Brassica napus mitogen-activated protein kinase kinase kinase Raf17.1 (Raf17.1) mRNA, complete cds.

KC190104; SV 1; linear; mRNA; STD; PLN; 1230 BP.
KC190104;
Brassica napus mitogen-activated protein kinase kinase kinase Raf28.1 (Raf28.1) mRNA, complete cds.

KC190105; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KC190105;
Brassica napus mitogen-activated protein kinase kinase kinase Raf29.1 (Raf29.1) mRNA, complete cds.

KC190106; SV 1; linear; mRNA; STD; PLN; 1704 BP.
KC190106;
Brassica napus mitogen-activated protein kinase kinase kinase Raf30.1 (Raf30.1) mRNA, complete cds.

KC190107; SV 1; linear; mRNA; STD; PLN; 1059 BP.
KC190107;
Brassica napus mitogen-activated protein kinase kinase kinase Raf34.1 (Raf34.1) mRNA, complete cds.

KC190108; SV 1; linear; mRNA; STD; PLN; 3189 BP.
KC190108;
Brassica napus mitogen-activated protein kinase kinase kinase Raf35.1 (Raf35.1) mRNA, complete cds.

KC190109; SV 1; linear; mRNA; STD; PLN; 1530 BP.
KC190109;
Brassica napus mitogen-activated protein kinase kinase kinase Raf36.1 (Raf36.1) mRNA, partial cds. FT                   NGCLGARLEKQFTKEVTLLSRLSHPNVIKFVGAYKDPPSYCVLTEYLPEGSLRSYLHKP

KC190110; SV 1; linear; mRNA; STD; PLN; 1137 BP.
KC190110;
Brassica napus mitogen-activated protein kinase kinase kinase Raf39.1 (Raf39.1) mRNA, complete cds.

KC790460; SV 1; linear; mRNA; STD; PLN; 813 BP.
KC790460;
Brassica rapa cultivar rapid-cycling CrGC 1-33 plasma membrane localized sucrose transporter (SWEET9) mRNA, complete cds.

KC797141; SV 1; linear; genomic DNA; STD; PLN; 956 BP.
KC797141;
Brassica napus transcription factor subunit NF-YC1 (NF-YC1) gene, complete cds.

KC797142; SV 1; linear; genomic DNA; STD; PLN; 943 BP.
KC797142;
Brassica napus transcription factor subunit NF-YC2 (NF-YC2) gene, complete cds; kinetoplast.

KC797143; SV 1; linear; genomic DNA; STD; PLN; 1203 BP.
KC797143;
Brassica napus transcription factor subunit NF-YC4 (NF-YC4) gene, complete cds.

KC797144; SV 1; linear; genomic DNA; STD; PLN; 1364 BP.
KC797144;
Brassica napus transcription factor subunit NF-YC9A (NF-YC9A) gene, complete cds.

KC797145; SV 1; linear; genomic DNA; STD; PLN; 1333 BP.
KC797145;
Brassica napus transcription factor subunit NF-YC9B (NF-YC9B) gene, complete cds.

KF577723; SV 1; linear; mRNA; STD; PLN; 1281 BP.
KF577723;
Brassica oleracea var. capitata ABA insensitive 1 mRNA, complete cds.

KF856616; SV 1; linear; mRNA; STD; PLN; 799 BP.
KF856616;
UNVERIFIED: Brassica oleracea var. viridis MADS box protein-like (AGL11) mRNA, complete sequence.

KF999615; SV 1; linear; genomic DNA; STD; PLN; 3008 BP.
KF999615;
Brassica rapa isolate D1 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999616; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999616;
Brassica rapa isolate D2 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999617; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999617;
Brassica rapa isolate D3 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999618; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999618;
Brassica rapa isolate D4 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999619; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999619;
Brassica rapa isolate D5 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999620; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999620;
Brassica rapa isolate D6 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999621; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999621;
Brassica rapa isolate D7 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999622; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999622;
Brassica rapa isolate D8 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999623; SV 1; linear; genomic DNA; STD; PLN; 3044 BP.
KF999623;
Brassica rapa isolate D9 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999624; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999624;
Brassica rapa isolate D10 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999625; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999625;
Brassica rapa isolate D11 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999626; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999626;
Brassica rapa isolate D12 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999627; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999627;
Brassica rapa isolate D13 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999628; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999628;
Brassica rapa isolate D14 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999629; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999629;
Brassica rapa isolate D15 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999630; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999630;
Brassica rapa isolate D16 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999631; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999631;
Brassica rapa isolate D17 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999632; SV 1; linear; genomic DNA; STD; PLN; 3030 BP.
KF999632;
Brassica rapa isolate D18 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999633; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999633;
Brassica rapa isolate D19 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999634; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999634;
Brassica rapa isolate D20 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999635; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999635;
Brassica rapa isolate D21 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999636; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999636;
Brassica rapa isolate D22 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999637; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999637;
Brassica rapa isolate D23 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999638; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999638;
Brassica rapa isolate D24 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999639; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999639;
Brassica rapa isolate D25 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KJ173682; SV 1; linear; mRNA; STD; PLN; 1133 BP.
KJ173682;
Brassica rapa cultivar Tsuda annexin protein 3 mRNA, complete cds.

KJ173683; SV 1; linear; mRNA; STD; PLN; 1142 BP.
KJ173683;
Brassica rapa cultivar Tsuda annexin protein 4 mRNA, complete cds.

KJ173684; SV 1; linear; mRNA; STD; PLN; 1056 BP.
KJ173684;
Brassica rapa cultivar Tsuda aquaporin (PIP1b1) mRNA, complete cds.

KJ173685; SV 1; linear; mRNA; STD; PLN; 902 BP.
KJ173685;
Brassica rapa cultivar Tsuda plasma-membrane associated cation-binding protein 1 mRNA, complete cds.

KJ173686; SV 1; linear; mRNA; STD; PLN; 743 BP.
KJ173686;
Brassica rapa cultivar Tsuda peptidylprolyl isomerase (ROC1) mRNA, complete cds.

KJ173687; SV 1; linear; mRNA; STD; PLN; 799 BP.
KJ173687;
Brassica rapa cultivar Tsuda peptidylprolyl isomerase (ROC2) mRNA, complete cds.

KJ476904; SV 1; linear; genomic DNA; STD; PLN; 746 BP.
KJ476904;
Brassica napus cultivar HZ002-2 HRa (HRa) gene, complete cds.

KJ476905; SV 1; linear; genomic DNA; STD; PLN; 746 BP.
KJ476905;
Brassica napus cultivar 0727/N103B HRa (HRa) gene, complete cds.

KJ476906; SV 1; linear; genomic DNA; STD; PLN; 746 BP.
KJ476906;
Brassica napus cultivar N102-5 HRa (HRa) gene, complete cds.

KJ476907; SV 1; linear; genomic DNA; STD; PLN; 746 BP.
KJ476907;
Brassica napus cultivar N104AB HRa (HRa) gene, complete cds.

KJ476908; SV 1; linear; genomic DNA; STD; PLN; 746 BP.
KJ476908;
Brassica napus cultivar N105-1 HRa (HRa) gene, complete cds.

KJ476909; SV 1; linear; genomic DNA; STD; PLN; 746 BP.
KJ476909;
Brassica napus cultivar Zh292 HRa (HRa) gene, complete cds.

KJ476910; SV 1; linear; genomic DNA; STD; PLN; 748 BP.
KJ476910;
Brassica napus cultivar R0 HRa (HRa) gene, complete cds.

KJ476911; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476911;
Brassica napus cultivar R0 HRb (HRb) gene, complete cds.

KJ476912; SV 1; linear; genomic DNA; STD; PLN; 756 BP.
KJ476912;
Brassica napus cultivar MY15-1-1 HRb (HRb) gene, complete cds.

KJ476913; SV 1; linear; genomic DNA; STD; PLN; 756 BP.
KJ476913;
Brassica napus cultivar MC0614 HRb (HRb) gene, complete cds.

KJ476914; SV 1; linear; genomic DNA; STD; PLN; 756 BP.
KJ476914;
Brassica napus cultivar M3AB HRb (HRb) gene, complete cds.

KJ476915; SV 1; linear; genomic DNA; STD; PLN; 756 BP.
KJ476915;
Brassica napus cultivar DY-8AB HRb (HRb) gene, complete cds.

KJ476916; SV 1; linear; genomic DNA; STD; PLN; 756 BP.
KJ476916;
Brassica napus cultivar Zhongyou821 HRb (HRb) gene, complete cds.

KJ476917; SV 1; linear; genomic DNA; STD; PLN; 756 BP.
KJ476917;
Brassica napus cultivar Westar HRb (HRb) gene, complete cds.

KJ476918; SV 1; linear; genomic DNA; STD; PLN; 756 BP.
KJ476918;
Brassica napus cultivar DY6AB-2 HRb (HRb) gene, complete cds.

KJ476919; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476919;
Brassica napus cultivar MC0411 HRb (HRb) gene, complete cds.

KJ476920; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476920;
Brassica napus cultivar ZYZ2-3 HRb (HRb) gene, complete cds.

KJ476921; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476921;
Brassica napus cultivar B33 HRb (HRb) gene, complete cds.

KJ476922; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476922;
Brassica napus cultivar ZhongShuang6 HRb (HRb) gene, complete cds.

KJ476923; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476923;
Brassica napus cultivar RS-2 HRb (HRb) gene, complete cds.

KJ476924; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476924;
Brassica napus cultivar SN3-6AB HRb (HRb) gene, complete cds.

KJ476925; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476925;
Brassica napus cultivar SN3-2AB HRb (HRb) gene, complete cds.

KJ476926; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476926;
Brassica napus cultivar D14 HRb (HRb) gene, complete cds.

KJ476927; SV 1; linear; genomic DNA; STD; PLN; 756 BP.
KJ476927;
Brassica napus cultivar MY15-1-1 HRc (HRc) gene, complete cds.

KJ476928; SV 1; linear; genomic DNA; STD; PLN; 755 BP.
KJ476928;
Brassica napus cultivar MY15-1-2 HRc (HRc) gene, complete cds.

KJ476929; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476929;
Brassica napus cultivar Zhongyou821 HRc (HRc) gene, complete cds.

KJ476930; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476930;
Brassica napus cultivar 0440 HRc (HRc) gene, complete cds.

KJ476931; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476931;
Brassica napus cultivar R9 HRc (HRc) gene, complete cds.

KJ476932; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476932;
Brassica napus cultivar MC0411/(GT)AB HRc (HRc) gene, complete cds.

KJ476933; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476933;
Brassica napus cultivar 120168-3-1 HRc (HRc) gene, complete cds.

KJ476934; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476934;
Brassica napus cultivar ZhongShuang6 HRc (HRc) gene, complete cds.

KJ476935; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476935;
Brassica napus cultivar Lenong-7 HRc (HRc) gene, complete cds.

KJ476936; SV 1; linear; genomic DNA; STD; PLN; 784 BP.
KJ476936;
Brassica napus cultivar N102-4 HRc (HRc) gene, complete cds.

KJ476937; SV 1; linear; genomic DNA; STD; PLN; 755 BP.
KJ476937;
Brassica napus cultivar MC0614 HRc (HRc) gene, complete cds.

KJ476938; SV 1; linear; genomic DNA; STD; PLN; 755 BP.
KJ476938;
Brassica napus cultivar RS-2 HRc (HRc) gene, complete cds.

KJ476939; SV 1; linear; genomic DNA; STD; PLN; 753 BP.
KJ476939;
Brassica napus cultivar CG07 HRc (HRc) gene, complete cds.

KJ476940; SV 1; linear; genomic DNA; STD; PLN; 1158 BP.
KJ476940;
Brassica napus cultivar MY15-1-1 HRd (HRd) gene, complete cds.

KJ476941; SV 1; linear; genomic DNA; STD; PLN; 1158 BP.
KJ476941;
Brassica napus cultivar R9 HRd (HRd) gene, complete cds.

KJ476942; SV 1; linear; genomic DNA; STD; PLN; 1151 BP.
KJ476942;
Brassica napus cultivar DY-8AB HRd (HRd) gene, complete cds.

KJ476943; SV 1; linear; genomic DNA; STD; PLN; 1158 BP.
KJ476943;
Brassica napus cultivar N109-7 HRd (HRd) gene, complete cds.

KJ476944; SV 1; linear; genomic DNA; STD; PLN; 1158 BP.
KJ476944;
Brassica napus cultivar MC02-4 HRd (HRd) gene, complete cds.

KJ533546; SV 1; linear; genomic DNA; STD; PLN; 1198 BP.
KJ533546;
UNVERIFIED: Brassica napus isolate ASSYST-001 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533547; SV 1; linear; genomic DNA; STD; PLN; 1203 BP.
KJ533547;
UNVERIFIED: Brassica napus isolate ASSYST-003 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533548; SV 1; linear; genomic DNA; STD; PLN; 1177 BP.
KJ533548;
UNVERIFIED: Brassica napus isolate ASSYST-006 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533549; SV 1; linear; genomic DNA; STD; PLN; 1207 BP.
KJ533549;
UNVERIFIED: Brassica napus isolate ASSYST-007 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533550; SV 1; linear; genomic DNA; STD; PLN; 1211 BP.
KJ533550;
UNVERIFIED: Brassica napus isolate ASSYST-008 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533551; SV 1; linear; genomic DNA; STD; PLN; 1200 BP.
KJ533551;
UNVERIFIED: Brassica napus isolate ASSYST-009 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533552; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
KJ533552;
UNVERIFIED: Brassica napus isolate ASSYST-011 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533553; SV 1; linear; genomic DNA; STD; PLN; 1209 BP.
KJ533553;
UNVERIFIED: Brassica napus isolate ASSYST-012 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533554; SV 1; linear; genomic DNA; STD; PLN; 1207 BP.
KJ533554;
UNVERIFIED: Brassica napus isolate ASSYST-013 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533555; SV 1; linear; genomic DNA; STD; PLN; 1211 BP.
KJ533555;
UNVERIFIED: Brassica napus isolate ASSYST-015 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533556; SV 1; linear; genomic DNA; STD; PLN; 1209 BP.
KJ533556;
UNVERIFIED: Brassica napus isolate ASSYST-016 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533557; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
KJ533557;
UNVERIFIED: Brassica napus isolate ASSYST-017 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533558; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
KJ533558;
UNVERIFIED: Brassica napus isolate ASSYST-018 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533559; SV 1; linear; genomic DNA; STD; PLN; 1204 BP.
KJ533559;
UNVERIFIED: Brassica napus isolate ASSYST-024 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533560; SV 1; linear; genomic DNA; STD; PLN; 1225 BP.
KJ533560;
UNVERIFIED: Brassica napus isolate ASSYST-034 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533561; SV 1; linear; genomic DNA; STD; PLN; 1187 BP.
KJ533561;
UNVERIFIED: Brassica napus isolate ASSYST-046 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533562; SV 1; linear; genomic DNA; STD; PLN; 1212 BP.
KJ533562;
UNVERIFIED: Brassica napus isolate ASSYST-049 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533563; SV 1; linear; genomic DNA; STD; PLN; 1199 BP.
KJ533563;
UNVERIFIED: Brassica napus isolate ASSYST-052 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533564; SV 1; linear; genomic DNA; STD; PLN; 1206 BP.
KJ533564;
UNVERIFIED: Brassica napus isolate ASSYST-054 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533565; SV 1; linear; genomic DNA; STD; PLN; 1154 BP.
KJ533565;
UNVERIFIED: Brassica napus isolate ASSYST-055 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533566; SV 1; linear; genomic DNA; STD; PLN; 1182 BP.
KJ533566;
UNVERIFIED: Brassica napus isolate ASSYST-059 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533567; SV 1; linear; genomic DNA; STD; PLN; 1187 BP.
KJ533567;
UNVERIFIED: Brassica napus isolate ASSYST-067 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533568; SV 1; linear; genomic DNA; STD; PLN; 1196 BP.
KJ533568;
UNVERIFIED: Brassica napus isolate ASSYST-086 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533569; SV 1; linear; genomic DNA; STD; PLN; 1175 BP.
KJ533569;
UNVERIFIED: Brassica napus isolate ASSYST-089 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533570; SV 1; linear; genomic DNA; STD; PLN; 1208 BP.
KJ533570;
UNVERIFIED: Brassica napus isolate ASSYST-096 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533571; SV 1; linear; genomic DNA; STD; PLN; 1220 BP.
KJ533571;
UNVERIFIED: Brassica napus isolate ASSYST-098 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533572; SV 1; linear; genomic DNA; STD; PLN; 1210 BP.
KJ533572;
UNVERIFIED: Brassica napus isolate ASSYST-102 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533573; SV 1; linear; genomic DNA; STD; PLN; 1216 BP.
KJ533573;
UNVERIFIED: Brassica napus isolate ASSYST-117 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533574; SV 1; linear; genomic DNA; STD; PLN; 1233 BP.
KJ533574;
UNVERIFIED: Brassica napus isolate ASSYST-130 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533575; SV 1; linear; genomic DNA; STD; PLN; 1206 BP.
KJ533575;
UNVERIFIED: Brassica napus isolate ASSYST-131 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533576; SV 1; linear; genomic DNA; STD; PLN; 1191 BP.
KJ533576;
UNVERIFIED: Brassica napus isolate ASSYST-150 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533577; SV 1; linear; genomic DNA; STD; PLN; 1207 BP.
KJ533577;
UNVERIFIED: Brassica napus isolate ASSYST-160 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533578; SV 1; linear; genomic DNA; STD; PLN; 1196 BP.
KJ533578;
UNVERIFIED: Brassica napus isolate ASSYST-180 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533579; SV 1; linear; genomic DNA; STD; PLN; 1210 BP.
KJ533579;
UNVERIFIED: Brassica napus isolate ASSYST-181 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533580; SV 1; linear; genomic DNA; STD; PLN; 1193 BP.
KJ533580;
UNVERIFIED: Brassica napus isolate ASSYST-185 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533581; SV 1; linear; genomic DNA; STD; PLN; 1153 BP.
KJ533581;
UNVERIFIED: Brassica napus isolate ASSYST-197 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533582; SV 1; linear; genomic DNA; STD; PLN; 1196 BP.
KJ533582;
UNVERIFIED: Brassica napus isolate ASSYST-210 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533583; SV 1; linear; genomic DNA; STD; PLN; 1204 BP.
KJ533583;
UNVERIFIED: Brassica napus isolate ASSYST-230 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533584; SV 1; linear; genomic DNA; STD; PLN; 1217 BP.
KJ533584;
UNVERIFIED: Brassica napus isolate ASSYST-232 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533585; SV 1; linear; genomic DNA; STD; PLN; 1211 BP.
KJ533585;
UNVERIFIED: Brassica napus isolate ASSYST-236 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533586; SV 1; linear; genomic DNA; STD; PLN; 1196 BP.
KJ533586;
UNVERIFIED: Brassica napus isolate ASSYST-237 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533587; SV 1; linear; genomic DNA; STD; PLN; 1222 BP.
KJ533587;
UNVERIFIED: Brassica napus isolate ASSYST-239 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533588; SV 1; linear; genomic DNA; STD; PLN; 1162 BP.
KJ533588;
UNVERIFIED: Brassica napus isolate ASSYST-240 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533589; SV 1; linear; genomic DNA; STD; PLN; 1159 BP.
KJ533589;
UNVERIFIED: Brassica napus isolate ASSYST-241 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533590; SV 1; linear; genomic DNA; STD; PLN; 1220 BP.
KJ533590;
UNVERIFIED: Brassica napus isolate ASSYST-242 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533591; SV 1; linear; genomic DNA; STD; PLN; 1212 BP.
KJ533591;
UNVERIFIED: Brassica napus isolate ASSYST-244 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533592; SV 1; linear; genomic DNA; STD; PLN; 1221 BP.
KJ533592;
UNVERIFIED: Brassica napus isolate ASSYST-250 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533593; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
KJ533593;
UNVERIFIED: Brassica napus isolate ASSYST-256 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533594; SV 1; linear; genomic DNA; STD; PLN; 1225 BP.
KJ533594;
UNVERIFIED: Brassica napus isolate ASSYST-268 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533595; SV 1; linear; genomic DNA; STD; PLN; 1213 BP.
KJ533595;
UNVERIFIED: Brassica napus isolate ASSYST-272 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533596; SV 1; linear; genomic DNA; STD; PLN; 1179 BP.
KJ533596;
UNVERIFIED: Brassica napus isolate ASSYST-274 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533597; SV 1; linear; genomic DNA; STD; PLN; 1233 BP.
KJ533597;
UNVERIFIED: Brassica napus isolate ASSYST-278 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533598; SV 1; linear; genomic DNA; STD; PLN; 1196 BP.
KJ533598;
UNVERIFIED: Brassica napus isolate ASSYST-280 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533599; SV 1; linear; genomic DNA; STD; PLN; 1209 BP.
KJ533599;
UNVERIFIED: Brassica napus isolate ASSYST-284 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533600; SV 1; linear; genomic DNA; STD; PLN; 1196 BP.
KJ533600;
UNVERIFIED: Brassica napus isolate ASSYST-285 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533601; SV 1; linear; genomic DNA; STD; PLN; 1211 BP.
KJ533601;
UNVERIFIED: Brassica napus isolate ASSYST-290 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533602; SV 1; linear; genomic DNA; STD; PLN; 1199 BP.
KJ533602;
UNVERIFIED: Brassica napus isolate ASSYST-291 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533603; SV 1; linear; genomic DNA; STD; PLN; 1217 BP.
KJ533603;
UNVERIFIED: Brassica napus isolate ASSYST-300 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533604; SV 1; linear; genomic DNA; STD; PLN; 1231 BP.
KJ533604;
UNVERIFIED: Brassica napus isolate ASSYST-305 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533605; SV 1; linear; genomic DNA; STD; PLN; 1216 BP.
KJ533605;
UNVERIFIED: Brassica napus isolate ASSYST-318 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533606; SV 1; linear; genomic DNA; STD; PLN; 1209 BP.
KJ533606;
UNVERIFIED: Brassica napus isolate ASSYST-325 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533607; SV 1; linear; genomic DNA; STD; PLN; 1195 BP.
KJ533607;
UNVERIFIED: Brassica napus isolate ASSYST-327 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533608; SV 1; linear; genomic DNA; STD; PLN; 1175 BP.
KJ533608;
UNVERIFIED: Brassica napus isolate ASSYST-328 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533609; SV 1; linear; genomic DNA; STD; PLN; 1211 BP.
KJ533609;
UNVERIFIED: Brassica napus isolate ASSYST-329 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533610; SV 1; linear; genomic DNA; STD; PLN; 1198 BP.
KJ533610;
UNVERIFIED: Brassica napus isolate ASSYST-330 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533611; SV 1; linear; genomic DNA; STD; PLN; 1210 BP.
KJ533611;
UNVERIFIED: Brassica napus isolate ASSYST-334 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533612; SV 1; linear; genomic DNA; STD; PLN; 1164 BP.
KJ533612;
UNVERIFIED: Brassica napus isolate ASSYST-339 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533613; SV 1; linear; genomic DNA; STD; PLN; 1229 BP.
KJ533613;
UNVERIFIED: Brassica napus isolate ASSYST-340 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533614; SV 1; linear; genomic DNA; STD; PLN; 1217 BP.
KJ533614;
UNVERIFIED: Brassica napus isolate ASSYST-342 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533615; SV 1; linear; genomic DNA; STD; PLN; 1198 BP.
KJ533615;
UNVERIFIED: Brassica napus isolate ASSYST-346 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533616; SV 1; linear; genomic DNA; STD; PLN; 1213 BP.
KJ533616;
UNVERIFIED: Brassica napus isolate ASSYST-347 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533617; SV 1; linear; genomic DNA; STD; PLN; 1169 BP.
KJ533617;
UNVERIFIED: Brassica napus isolate ASSYST-348 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533618; SV 1; linear; genomic DNA; STD; PLN; 1211 BP.
KJ533618;
UNVERIFIED: Brassica napus isolate ASSYST-349 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533619; SV 1; linear; genomic DNA; STD; PLN; 1176 BP.
KJ533619;
UNVERIFIED: Brassica napus isolate ASSYST-360 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533620; SV 1; linear; genomic DNA; STD; PLN; 1221 BP.
KJ533620;
UNVERIFIED: Brassica napus isolate ASSYST-361 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533621; SV 1; linear; genomic DNA; STD; PLN; 1173 BP.
KJ533621;
UNVERIFIED: Brassica napus isolate ASSYST-372 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533622; SV 1; linear; genomic DNA; STD; PLN; 1210 BP.
KJ533622;
UNVERIFIED: Brassica napus isolate ASSYST-374 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533623; SV 1; linear; genomic DNA; STD; PLN; 1192 BP.
KJ533623;
UNVERIFIED: Brassica napus isolate ASSYST-427 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533624; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
KJ533624;
UNVERIFIED: Brassica napus isolate ASSYST-431 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533625; SV 1; linear; genomic DNA; STD; PLN; 1193 BP.
KJ533625;
UNVERIFIED: Brassica napus isolate ASSYST-466 terminal flower 1-2-like (TFL1-2) gene, complete sequence.

KJ533626; SV 1; linear; genomic DNA; STD; PLN; 695 BP.
KJ533626;
UNVERIFIED: Brassica napus isolate ASSYST-002 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533627; SV 1; linear; genomic DNA; STD; PLN; 696 BP.
KJ533627;
Brassica napus isolate ASSYST-003 flowering locus T (C6FTb) gene, partial cds.

KJ533628; SV 1; linear; genomic DNA; STD; PLN; 694 BP.
KJ533628;
Brassica napus isolate ASSYST-004 flowering locus T (C6FTb) gene, partial cds.

KJ533629; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533629;
UNVERIFIED: Brassica napus isolate ASSYST-005 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533630; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533630;
UNVERIFIED: Brassica napus isolate ASSYST-006 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533631; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533631;
Brassica napus isolate ASSYST-009 flowering locus T (C6FTb) gene, partial cds.

KJ533632; SV 1; linear; genomic DNA; STD; PLN; 693 BP.
KJ533632;
Brassica napus isolate ASSYST-012 flowering locus T (C6FTb) gene, partial cds.

KJ533633; SV 1; linear; genomic DNA; STD; PLN; 705 BP.
KJ533633;
UNVERIFIED: Brassica napus isolate ASSYST-013 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533634; SV 1; linear; genomic DNA; STD; PLN; 724 BP.
KJ533634;
Brassica napus isolate ASSYST-014 flowering locus T (C6FTb) gene, partial cds.

KJ533635; SV 1; linear; genomic DNA; STD; PLN; 698 BP.
KJ533635;
Brassica napus isolate ASSYST-015 flowering locus T (C6FTb) gene, partial cds.

KJ533636; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533636;
UNVERIFIED: Brassica napus isolate ASSYST-016 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533637; SV 1; linear; genomic DNA; STD; PLN; 692 BP.
KJ533637;
UNVERIFIED: Brassica napus isolate ASSYST-017 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533638; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533638;
UNVERIFIED: Brassica napus isolate ASSYST-018 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533639; SV 1; linear; genomic DNA; STD; PLN; 724 BP.
KJ533639;
UNVERIFIED: Brassica napus isolate ASSYST-021 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533640; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533640;
UNVERIFIED: Brassica napus isolate ASSYST-024 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533641; SV 1; linear; genomic DNA; STD; PLN; 694 BP.
KJ533641;
Brassica napus isolate ASSYST-026 flowering locus T (C6FTb) gene, partial cds.

KJ533642; SV 1; linear; genomic DNA; STD; PLN; 700 BP.
KJ533642;
Brassica napus isolate ASSYST-034 flowering locus T (C6FTb) gene, partial cds.

KJ533643; SV 1; linear; genomic DNA; STD; PLN; 721 BP.
KJ533643;
UNVERIFIED: Brassica napus isolate ASSYST-046 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533644; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533644;
UNVERIFIED: Brassica napus isolate ASSYST-049 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533645; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533645;
UNVERIFIED: Brassica napus isolate ASSYST-054 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533646; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533646;
UNVERIFIED: Brassica napus isolate ASSYST-059 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533647; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533647;
UNVERIFIED: Brassica napus isolate ASSYST-067 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533648; SV 1; linear; genomic DNA; STD; PLN; 714 BP.
KJ533648;
UNVERIFIED: Brassica napus isolate ASSYST-080 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533649; SV 1; linear; genomic DNA; STD; PLN; 695 BP.
KJ533649;
Brassica napus isolate ASSYST-086 flowering locus T (C6FTb) gene, partial cds.

KJ533650; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533650;
Brassica napus isolate ASSYST-088 flowering locus T (C6FTb) gene, partial cds.

KJ533651; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533651;
UNVERIFIED: Brassica napus isolate ASSYST-089 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533652; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533652;
UNVERIFIED: Brassica napus isolate ASSYST-096 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533653; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533653;
UNVERIFIED: Brassica napus isolate ASSYST-098 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533654; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533654;
Brassica napus isolate ASSYST-102 flowering locus T (C6FTb) gene, partial cds.

KJ533655; SV 1; linear; genomic DNA; STD; PLN; 722 BP.
KJ533655;
UNVERIFIED: Brassica napus isolate ASSYST-113 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533656; SV 1; linear; genomic DNA; STD; PLN; 696 BP.
KJ533656;
Brassica napus isolate ASSYST-117 flowering locus T (C6FTb) gene, partial cds.

KJ533657; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533657;
UNVERIFIED: Brassica napus isolate ASSYST-119 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533658; SV 1; linear; genomic DNA; STD; PLN; 714 BP.
KJ533658;
UNVERIFIED: Brassica napus isolate ASSYST-128 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533659; SV 1; linear; genomic DNA; STD; PLN; 720 BP.
KJ533659;
UNVERIFIED: Brassica napus isolate ASSYST-130 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533660; SV 1; linear; genomic DNA; STD; PLN; 703 BP.
KJ533660;
Brassica napus isolate ASSYST-150 flowering locus T (C6FTb) gene, partial cds.

KJ533661; SV 1; linear; genomic DNA; STD; PLN; 719 BP.
KJ533661;
UNVERIFIED: Brassica napus isolate ASSYST-160 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533662; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533662;
UNVERIFIED: Brassica napus isolate ASSYST-166 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533663; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533663;
Brassica napus isolate ASSYST-178 flowering locus T (C6FTb) gene, partial cds.

KJ533664; SV 1; linear; genomic DNA; STD; PLN; 713 BP.
KJ533664;
UNVERIFIED: Brassica napus isolate ASSYST-180 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533665; SV 1; linear; genomic DNA; STD; PLN; 693 BP.
KJ533665;
Brassica napus isolate ASSYST-181 flowering locus T (C6FTb) gene, partial cds.

KJ533666; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533666;
UNVERIFIED: Brassica napus isolate ASSYST-193 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533667; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533667;
UNVERIFIED: Brassica napus isolate ASSYST-197 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533668; SV 1; linear; genomic DNA; STD; PLN; 706 BP.
KJ533668;
UNVERIFIED: Brassica napus isolate ASSYST-210 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533669; SV 1; linear; genomic DNA; STD; PLN; 725 BP.
KJ533669;
UNVERIFIED: Brassica napus isolate ASSYST-212 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533670; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533670;
UNVERIFIED: Brassica napus isolate ASSYST-218 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533671; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533671;
UNVERIFIED: Brassica napus isolate ASSYST-232 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533672; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533672;
UNVERIFIED: Brassica napus isolate ASSYST-236 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533673; SV 1; linear; genomic DNA; STD; PLN; 697 BP.
KJ533673;
Brassica napus isolate ASSYST-237 flowering locus T (C6FTb) gene, partial cds.

KJ533674; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533674;
UNVERIFIED: Brassica napus isolate ASSYST-239 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533675; SV 1; linear; genomic DNA; STD; PLN; 714 BP.
KJ533675;
UNVERIFIED: Brassica napus isolate ASSYST-240 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533676; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533676;
UNVERIFIED: Brassica napus isolate ASSYST-242 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533677; SV 1; linear; genomic DNA; STD; PLN; 693 BP.
KJ533677;
Brassica napus isolate ASSYST-244 flowering locus T (C6FTb) gene, partial cds.

KJ533678; SV 1; linear; genomic DNA; STD; PLN; 749 BP.
KJ533678;
UNVERIFIED: Brassica napus isolate ASSYST-250 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533679; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533679;
UNVERIFIED: Brassica napus isolate ASSYST-251 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533680; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533680;
UNVERIFIED: Brassica napus isolate ASSYST-253 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533681; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533681;
Brassica napus isolate ASSYST-254 flowering locus T (C6FTb) gene, partial cds.

KJ533682; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533682;
UNVERIFIED: Brassica napus isolate ASSYST-256 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533683; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533683;
UNVERIFIED: Brassica napus isolate ASSYST-268 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533684; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533684;
UNVERIFIED: Brassica napus isolate ASSYST-271 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533685; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533685;
UNVERIFIED: Brassica napus isolate ASSYST-272 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533686; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533686;
UNVERIFIED: Brassica napus isolate ASSYST-274 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533687; SV 1; linear; genomic DNA; STD; PLN; 748 BP.
KJ533687;
UNVERIFIED: Brassica napus isolate ASSYST-276 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533688; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533688;
UNVERIFIED: Brassica napus isolate ASSYST-278 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533689; SV 1; linear; genomic DNA; STD; PLN; 698 BP.
KJ533689;
UNVERIFIED: Brassica napus isolate ASSYST-280 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533690; SV 1; linear; genomic DNA; STD; PLN; 695 BP.
KJ533690;
Brassica napus isolate ASSYST-281 flowering locus T (C6FTb) gene, partial cds.

KJ533691; SV 1; linear; genomic DNA; STD; PLN; 714 BP.
KJ533691;
UNVERIFIED: Brassica napus isolate ASSYST-284 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533692; SV 1; linear; genomic DNA; STD; PLN; 697 BP.
KJ533692;
UNVERIFIED: Brassica napus isolate ASSYST-285 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533693; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533693;
UNVERIFIED: Brassica napus isolate ASSYST-288 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533694; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533694;
UNVERIFIED: Brassica napus isolate ASSYST-290 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533695; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533695;
UNVERIFIED: Brassica napus isolate ASSYST-291 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533696; SV 1; linear; genomic DNA; STD; PLN; 714 BP.
KJ533696;
UNVERIFIED: Brassica napus isolate ASSYST-299 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533697; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533697;
UNVERIFIED: Brassica napus isolate ASSYST-300 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533698; SV 1; linear; genomic DNA; STD; PLN; 741 BP.
KJ533698;
UNVERIFIED: Brassica napus isolate ASSYST-302 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533699; SV 1; linear; genomic DNA; STD; PLN; 705 BP.
KJ533699;
Brassica napus isolate ASSYST-305 flowering locus T (C6FTb) gene, partial cds.

KJ533700; SV 1; linear; genomic DNA; STD; PLN; 696 BP.
KJ533700;
Brassica napus isolate ASSYST-306 flowering locus T (C6FTb) gene, partial cds.

KJ533701; SV 1; linear; genomic DNA; STD; PLN; 719 BP.
KJ533701;
UNVERIFIED: Brassica napus isolate ASSYST-307 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533702; SV 1; linear; genomic DNA; STD; PLN; 714 BP.
KJ533702;
UNVERIFIED: Brassica napus isolate ASSYST-309 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533703; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533703;
UNVERIFIED: Brassica napus isolate ASSYST-312 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533704; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533704;
UNVERIFIED: Brassica napus isolate ASSYST-313 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533705; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533705;
UNVERIFIED: Brassica napus isolate ASSYST-314 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533706; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533706;
Brassica napus isolate ASSYST-315 flowering locus T (C6FTb) gene, partial cds.

KJ533707; SV 1; linear; genomic DNA; STD; PLN; 694 BP.
KJ533707;
Brassica napus isolate ASSYST-316 flowering locus T (C6FTb) gene, partial cds.

KJ533708; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533708;
UNVERIFIED: Brassica napus isolate ASSYST-317 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533709; SV 1; linear; genomic DNA; STD; PLN; 693 BP.
KJ533709;
Brassica napus isolate ASSYST-318 flowering locus T (C6FTb) gene, partial cds.

KJ533710; SV 1; linear; genomic DNA; STD; PLN; 693 BP.
KJ533710;
Brassica napus isolate ASSYST-325 flowering locus T (C6FTb) gene, partial cds.

KJ533711; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533711;
UNVERIFIED: Brassica napus isolate ASSYST-327 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533712; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533712;
Brassica napus isolate ASSYST-328 flowering locus T (C6FTb) gene, partial cds.

KJ533713; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533713;
UNVERIFIED: Brassica napus isolate ASSYST-330 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533714; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533714;
UNVERIFIED: Brassica napus isolate ASSYST-334 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533715; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533715;
UNVERIFIED: Brassica napus isolate ASSYST-335 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533716; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533716;
UNVERIFIED: Brassica napus isolate ASSYST-339 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533717; SV 1; linear; genomic DNA; STD; PLN; 715 BP.
KJ533717;
UNVERIFIED: Brassica napus isolate ASSYST-340 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533718; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533718;
UNVERIFIED: Brassica napus isolate ASSYST-342 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533719; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533719;
UNVERIFIED: Brassica napus isolate ASSYST-346 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533720; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533720;
UNVERIFIED: Brassica napus isolate ASSYST-347 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533721; SV 1; linear; genomic DNA; STD; PLN; 702 BP.
KJ533721;
UNVERIFIED: Brassica napus isolate ASSYST-348 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533722; SV 1; linear; genomic DNA; STD; PLN; 692 BP.
KJ533722;
Brassica napus isolate ASSYST-349 flowering locus T (C6FTb) gene, partial cds.

KJ533723; SV 1; linear; genomic DNA; STD; PLN; 719 BP.
KJ533723;
UNVERIFIED: Brassica napus isolate ASSYST-360 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533724; SV 1; linear; genomic DNA; STD; PLN; 718 BP.
KJ533724;
UNVERIFIED: Brassica napus isolate ASSYST-361 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533725; SV 1; linear; genomic DNA; STD; PLN; 717 BP.
KJ533725;
UNVERIFIED: Brassica napus isolate ASSYST-366 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533726; SV 1; linear; genomic DNA; STD; PLN; 694 BP.
KJ533726;
UNVERIFIED: Brassica napus isolate ASSYST-372 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533727; SV 1; linear; genomic DNA; STD; PLN; 721 BP.
KJ533727;
UNVERIFIED: Brassica napus isolate ASSYST-454 flowering locus T-like (C6FTb) gene, partial sequence.

KJ533728; SV 1; linear; genomic DNA; STD; PLN; 716 BP.
KJ533728;
Brassica napus isolate ASSYST-466 flowering locus T (C6FTb) gene, partial cds.


14/05/2014

AB702691; SV 1; linear; mRNA; STD; PLN; 966 BP.
AB702691;
Brassica oleracea var. viridis mRNA for Myb domain protein 29 (BoMyb29), complete cds.

AB702692; SV 1; linear; mRNA; STD; PLN; 1059 BP.
AB702692;
Brassica oleracea var. viridis mRNA for Myb domain protein 28-1 (BoMyb28-1), complete cds.

AB702693; SV 1; linear; mRNA; STD; PLN; 1089 BP.
AB702693;
Brassica oleracea var. viridis mRNA for Myb domain protein 28-2 (BoMyb28-2), complete cds.

AB702694; SV 1; linear; mRNA; STD; PLN; 1029 BP.
AB702694;
Brassica oleracea var. viridis mRNA for Myb domain protein 28-3 (BoMyb28-3), complete cds.

AB702695; SV 1; linear; mRNA; STD; PLN; 951 BP.
AB702695;
Brassica oleracea var. viridis mRNA for Myb domain protein 34 (BoMyb34), complete cds.


13/05/2014

KF926859; SV 1; linear; mRNA; STD; PLN; 1089 BP.
KF926859;
Brassica rapa meiotic recombination protein (SPO11-1) mRNA, complete cds.

KF926860; SV 1; linear; mRNA; STD; PLN; 1143 BP.
KF926860;
Brassica rapa meiotic recombination protein (SPO11-2) mRNA, complete cds.


12/05/2014

KJ184845; SV 1; linear; mRNA; STD; PLN; 1143 BP.
KJ184845;
Brassica napus lysophosphatidyl acyltransferase 4-1 mRNA, complete cds.

KJ184846; SV 1; linear; mRNA; STD; PLN; 1140 BP.
KJ184846;
Brassica napus lysophosphatidyl acyltransferase 4-2 mRNA, complete cds.

KJ184847; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KJ184847;
Brassica napus lysophosphatidyl acyltransferase 5 mRNA, complete cds.


10/05/2014

JN872633; SV 1; linear; genomic DNA; STD; PLN; 2124 BP.
JN872633;
Brassica rapa subsp. oleifera leucine-rich repeat receptor-like kinase (LRK01) gene, complete cds.


03/05/2014

BK000113; SV 1; linear; mRNA; STD; PLN; 215 BP.
BK000113;
TPA: Brassica napus putative phytosulfokine peptide precursor (PSK1) mRNA, partial cds.

GR301387;
BoBF1 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301388; SV 1; linear; mRNA; EST; PLN; 143 BP.
GR301388;
BoBF2 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301389; SV 1; linear; mRNA; EST; PLN; 188 BP.
GR301389;
BoBF3 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301390; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301390;
BoBF4 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301391; SV 1; linear; mRNA; EST; PLN; 135 BP.
GR301391;
BoBF5 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301392; SV 1; linear; mRNA; EST; PLN; 91 BP.
GR301392;
BoBF6 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301393; SV 1; linear; mRNA; EST; PLN; 84 BP.
GR301393;
BoBF7 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301394; SV 1; linear; mRNA; EST; PLN; 213 BP.
GR301394;
BoBF8 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301395; SV 1; linear; mRNA; EST; PLN; 311 BP.
GR301395;
BoBF9 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301396; SV 1; linear; mRNA; EST; PLN; 310 BP.
GR301396;
BoBF10 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301397; SV 1; linear; mRNA; EST; PLN; 177 BP.
GR301397;
BoBF11 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301398; SV 1; linear; mRNA; EST; PLN; 176 BP.
GR301398;
BoBF12 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301399; SV 1; linear; mRNA; EST; PLN; 186 BP.
GR301399;
BoBF13 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301400; SV 1; linear; mRNA; EST; PLN; 128 BP.
GR301400;
BoBF14 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301401; SV 1; linear; mRNA; EST; PLN; 127 BP.
GR301401;
BoBF15 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301402; SV 1; linear; mRNA; EST; PLN; 181 BP.
GR301402;
BoBF16 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301403; SV 1; linear; mRNA; EST; PLN; 101 BP.
GR301403;
BoBF17 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301404; SV 1; linear; mRNA; EST; PLN; 105 BP.
GR301404;
BoBF18 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301405; SV 1; linear; mRNA; EST; PLN; 98 BP.
GR301405;
BoBF19 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301406; SV 1; linear; mRNA; EST; PLN; 320 BP.
GR301406;
BoBF20 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301407; SV 1; linear; mRNA; EST; PLN; 109 BP.
GR301407;
BoBF21 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301408; SV 1; linear; mRNA; EST; PLN; 108 BP.
GR301408;
BoBF22 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301409; SV 1; linear; mRNA; EST; PLN; 99 BP.
GR301409;
BoBF23 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301410; SV 1; linear; mRNA; EST; PLN; 129 BP.
GR301410;
BoBF24 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301411; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301411;
BoBF25 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301412; SV 1; linear; mRNA; EST; PLN; 78 BP.
GR301412;
BoBF26 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301413; SV 1; linear; mRNA; EST; PLN; 236 BP.
GR301413;
BoCF1 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301414; SV 1; linear; mRNA; EST; PLN; 143 BP.
GR301414;
BoCF2 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301415; SV 1; linear; mRNA; EST; PLN; 188 BP.
GR301415;
BoCF3 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301416; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301416;
BoCF4 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301417; SV 1; linear; mRNA; EST; PLN; 135 BP.
GR301417;
BoCF5 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301418; SV 1; linear; mRNA; EST; PLN; 91 BP.
GR301418;
BoCF6 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301419; SV 1; linear; mRNA; EST; PLN; 84 BP.
GR301419;
BoCF7 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301420; SV 1; linear; mRNA; EST; PLN; 213 BP.
GR301420;
BoCF8 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301421; SV 1; linear; mRNA; EST; PLN; 177 BP.
GR301421;
BoCF11 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301422; SV 1; linear; mRNA; EST; PLN; 176 BP.
GR301422;
BoCF12 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301423; SV 1; linear; mRNA; EST; PLN; 186 BP.
GR301423;
BoCF13 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301424; SV 1; linear; mRNA; EST; PLN; 128 BP.
GR301424;
BoCF14 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301425; SV 1; linear; mRNA; EST; PLN; 127 BP.
GR301425;
BoCF15 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301426; SV 1; linear; mRNA; EST; PLN; 181 BP.
GR301426;
BoCF16 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301427; SV 1; linear; mRNA; EST; PLN; 101 BP.
GR301427;
BoCF17 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301428; SV 1; linear; mRNA; EST; PLN; 105 BP.
GR301428;
BoCF18 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301429; SV 1; linear; mRNA; EST; PLN; 98 BP.
GR301429;
BoCF19 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301430; SV 1; linear; mRNA; EST; PLN; 320 BP.
GR301430;
BoCF20 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301431; SV 1; linear; mRNA; EST; PLN; 109 BP.
GR301431;
BoCF21 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301432; SV 1; linear; mRNA; EST; PLN; 108 BP.
GR301432;
BoCF22 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301433; SV 1; linear; mRNA; EST; PLN; 99 BP.
GR301433;
BoCF23 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301434; SV 1; linear; mRNA; EST; PLN; 129 BP.
GR301434;
BoCF24 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301435; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301435;
BoCF25 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301436; SV 1; linear; mRNA; EST; PLN; 78 BP.
GR301436;
BoCF26 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR312927; SV 1; linear; mRNA; EST; PLN; 650 BP.
GR312927;
BoBFysx301 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312928; SV 1; linear; mRNA; EST; PLN; 216 BP.
GR312928;
BoBFysx304 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312929; SV 1; linear; mRNA; EST; PLN; 802 BP.
GR312929;
BoBFysx305 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312930; SV 1; linear; mRNA; EST; PLN; 582 BP.
GR312930;
BoBFysx308 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312931; SV 1; linear; mRNA; EST; PLN; 437 BP.
GR312931;
BoBFysx309 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312932; SV 1; linear; mRNA; EST; PLN; 1034 BP.
GR312932;
BoBFysx310 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312933; SV 1; linear; mRNA; EST; PLN; 384 BP.
GR312933;
BoBFysx313 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312934; SV 1; linear; mRNA; EST; PLN; 635 BP.
GR312934;
BoBFysx316 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312935; SV 1; linear; mRNA; EST; PLN; 1047 BP.
GR312935;
BoBFysx318 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312936; SV 1; linear; mRNA; EST; PLN; 295 BP.
GR312936;
BoBFysx319 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312937; SV 1; linear; mRNA; EST; PLN; 501 BP.
GR312937;
BoBFysx320 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312938; SV 1; linear; mRNA; EST; PLN; 492 BP.
GR312938;
BoBFysx325 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312939; SV 1; linear; mRNA; EST; PLN; 447 BP.
GR312939;
BoBFysx326 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

JN039346; SV 1; linear; mRNA; STD; PLN; 1417 BP.
JN039346;
Brassica rapa subsp. chinensis cultivar Suzhouqing mannose-6-phosphate isomerase-like protein (PMI2) mRNA, complete cds.

JN806156; SV 1; linear; mRNA; STD; PLN; 1254 BP.
JN806156;
Brassica napus PHR1 (PHR1) mRNA, complete cds.

JQ317330; SV 1; linear; genomic DNA; STD; PLN; 1497 BP.
JQ317330;
Brassica rapa BrEXPA1 (EXPA1) gene, promoter region.

JQ708046; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ708046;
Brassica napus calcineurin B-like 1.1 (CBL1.1) mRNA, complete cds.

JQ708047; SV 1; linear; mRNA; STD; PLN; 750 BP.
JQ708047;
Brassica napus calcineurin B-like 10.1 (CBL10.1) mRNA, complete cds.

JQ708048; SV 1; linear; mRNA; STD; PLN; 681 BP.
JQ708048;
Brassica napus calcineurin B-like 2.1 (CBL2.1) mRNA, complete cds.

JQ708049; SV 1; linear; mRNA; STD; PLN; 681 BP.
JQ708049;
Brassica napus calcineurin B-like 3.1 (CBL3.1) mRNA, complete cds.

JQ708050; SV 1; linear; mRNA; STD; PLN; 666 BP.
JQ708050;
Brassica napus calcineurin B-like 4.1 (CBL4.1) mRNA, complete cds.

JQ708051; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ708051;
Brassica napus calcineurin B-like 9.1 (CBL9.1) mRNA, complete cds.

JQ708052; SV 1; linear; mRNA; STD; PLN; 1335 BP.
JQ708052;
Brassica napus CBL-interacting protein kinase 1.1 (CIPK1.1) mRNA, complete cds.

JQ708053; SV 1; linear; mRNA; STD; PLN; 1394 BP.
JQ708053;
Brassica napus CBL-interacting protein kinase 10.1 (CIPK10.1) mRNA, complete cds.

JQ708054; SV 1; linear; mRNA; STD; PLN; 1332 BP.
JQ708054;
Brassica napus CBL-interacting protein kinase 11.1 (CIPK11.1) mRNA, complete cds.

JQ708055; SV 1; linear; mRNA; STD; PLN; 1476 BP.
JQ708055;
Brassica napus CBL-interacting protein kinase 12.1 (CIPK12.1) mRNA, complete cds.

JQ708056; SV 1; linear; mRNA; STD; PLN; 1272 BP.
JQ708056;
Brassica napus CBL-interacting protein kinase 15.1 (CIPK15.1) mRNA, complete cds.

JQ708057; SV 1; linear; mRNA; STD; PLN; 1285 BP.
JQ708057;
Brassica napus CBL-interacting protein kinase 17.1 (CIPK17.1) mRNA, complete cds.

JQ708058; SV 1; linear; mRNA; STD; PLN; 1449 BP.
JQ708058;
Brassica napus CBL-interacting protein kinase 23.1 (CIPK23.1) mRNA, complete cds.

JQ708059; SV 1; linear; mRNA; STD; PLN; 1362 BP.
JQ708059;
Brassica napus CBL-interacting protein kinase 24.1 (CIPK24.1) mRNA, complete cds.

JQ708060; SV 1; linear; mRNA; STD; PLN; 1326 BP.
JQ708060;
Brassica napus CBL-interacting protein kinase 26.1 (CIPK26.1) mRNA, complete cds.

JQ708061; SV 1; linear; mRNA; STD; PLN; 1322 BP.
JQ708061;
Brassica napus CBL-interacting protein kinase 3.1 (CIPK3.1) mRNA, partial cds.

JQ708062; SV 1; linear; mRNA; STD; PLN; 1296 BP.
JQ708062;
Brassica napus CBL-interacting protein kinase 5.1 (CIPK5.1) mRNA, complete cds.

JQ708063; SV 1; linear; mRNA; STD; PLN; 1314 BP.
JQ708063;
Brassica napus CBL-interacting protein kinase 6.1 (CIPK6.1) mRNA, complete cds.

JQ708064; SV 1; linear; mRNA; STD; PLN; 1245 BP.
JQ708064;
Brassica napus CBL-interacting protein kinase 7.1 (CIPK7.1) mRNA, complete cds.

JQ708065; SV 1; linear; mRNA; STD; PLN; 1356 BP.
JQ708065;
Brassica napus CBL-interacting protein kinase 8.1 (CIPK8.1) mRNA, complete cds.

JQ708066; SV 1; linear; mRNA; STD; PLN; 1347 BP.
JQ708066;
Brassica napus CBL-interacting protein kinase 9.1 (CIPK9.1) mRNA, complete cds. FT                   PNLMTLYKRICKAEFNCPPWFSPGAKNVIKRILDPSPITRISIAELLEDEWFKQGYKTP

JQ911379; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911379;
Brassica napus voucher BGV UPM 399075 psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911384; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911384;
Brassica oleracea var. alboglabra voucher BGV UPM 2862 psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911385; SV 1; linear; genomic DNA; STD; PLN; 724 BP.
JQ911385;
Brassica oleracea var. gemmifera psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911386; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911386;
Brassica oleracea var. gemmifera voucher TA449 (MO, UMO) psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911387; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911387;
Brassica oleracea var. gongylodes voucher TA460 (MO, UMO) psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911388; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911388;
Brassica oleracea voucher TA432 (MO, UMO) psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911391; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911391;
Brassica rapa voucher IMB 218 psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911502; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911502;
Brassica rapa subsp. chinensis voucher BGV UPM 126370 psbD-trnT intergenic spacer, partial sequence; chloroplast.

JX306690; SV 1; linear; mRNA; STD; PLN; 1279 BP.
JX306690;
Brassica napus clone MPIZp1022G0813Q glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306691; SV 1; linear; mRNA; STD; PLN; 950 BP.
JX306691;
Brassica napus clone MPIZp1022A1123Q glutamine synthetase 1 (GLN1.5) mRNA, partial cds.

JX306692; SV 1; linear; mRNA; STD; PLN; 1178 BP.
JX306692;
Brassica napus clone MPIZp1022C0924Q glutamine synthetase 1 (GLN1.4) mRNA, partial sequence.

JX306693; SV 1; linear; mRNA; STD; PLN; 1218 BP.
JX306693;
Brassica napus clone BN20.052B22 glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306694; SV 1; linear; mRNA; STD; PLN; 1257 BP.
JX306694;
Brassica napus clone BN40.043K19 glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306695; SV 1; linear; mRNA; STD; PLN; 1309 BP.
JX306695;
Brassica napus clone BN15.001A07 glutamine synthetase 1 (GLN1.4) mRNA, complete cds.

JX306696; SV 1; linear; mRNA; STD; PLN; 1104 BP.
JX306696;
Brassica napus clone BnGS_Gln1-4_61_G4_c1 glutamine synthetase 1 (GLN1.4) mRNA, complete sequence.

JX306697; SV 1; linear; mRNA; STD; PLN; 1103 BP.
JX306697;
Brassica napus clone BnGS_Gln1-4_61_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, complete cds.

JX306698; SV 1; linear; mRNA; STD; PLN; 784 BP.
JX306698;
Brassica napus clone BnGS1.63_G4_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306699; SV 1; linear; mRNA; STD; PLN; 784 BP.
JX306699;
Brassica napus clone BnGS1.63_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306700; SV 1; linear; mRNA; STD; PLN; 758 BP.
JX306700;
Brassica napus clone BnGS1.64_G4_c2 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306701; SV 1; linear; mRNA; STD; PLN; 758 BP.
JX306701;
Brassica napus clone BnGS1.64_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306702; SV 1; linear; mRNA; STD; PLN; 411 BP.
JX306702;
Brassica napus glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306703; SV 1; linear; mRNA; STD; PLN; 371 BP.
JX306703;
Brassica napus glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306704; SV 1; linear; genomic DNA; STD; PLN; 1685 BP.
JX306704;
Brassica napus clone BnGS1-63-T_ADNg3 glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306705; SV 1; linear; genomic DNA; STD; PLN; 1685 BP.
JX306705;
Brassica napus clone BnGS1-63-E_ADNg3 glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306706; SV 1; linear; genomic DNA; STD; PLN; 1699 BP.
JX306706;
Brassica napus clone BnGS1-64-E glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306707; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
JX306707;
Brassica napus clone BnGS1-63-T_2U-3L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306708; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
JX306708;
Brassica napus clone BnGS1-63-E_2U-3L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306709; SV 1; linear; genomic DNA; STD; PLN; 1181 BP.
JX306709;
Brassica napus clone BnGS1-64-E_2U-2L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306710; SV 1; linear; genomic DNA; STD; PLN; 1184 BP.
JX306710;
Brassica napus clone BnGS1-64-Dn_2U-2L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306711; SV 1; linear; genomic DNA; STD; PLN; 1610 BP.
JX306711;
Brassica napus clone BnGS1-64-Dn_5U-5L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX944041; SV 1; linear; mRNA; STD; PLN; 1627 BP.
JX944041;
Brassica oleracea clone BoRCA1 chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase activase precursor protein mRNA, complete cds; nuclear gene for chloroplast product.

JX944042; SV 1; linear; mRNA; STD; PLN; 1640 BP.
JX944042;
Brassica oleracea clone BoRCA2 chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase activase precursor protein mRNA, complete cds; nuclear gene for chloroplast product.

JX971618; SV 1; linear; mRNA; STD; PLN; 1016 BP.
JX971618;
Brassica oleracea cultivar Gold Acer male sterility related AT-hook DNA binding protein (MF2) mRNA, complete cds.

KC190095; SV 1; linear; mRNA; STD; PLN; 1104 BP.
KC190095;
Brassica napus mitogen-activated protein kinase kinase kinase 17.1 (MAPKKK17.1) mRNA, complete cds.

KC190096; SV 1; linear; mRNA; STD; PLN; 1014 BP.
KC190096;
Brassica napus mitogen-activated protein kinase kinase kinase 18.1 (MAPKKK18.1) mRNA, complete cds.

KC190097; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KC190097;
Brassica napus mitogen-activated protein kinase kinase kinase 19.1 (MAPKKK19.1) mRNA, complete cds.

KC190098; SV 1; linear; mRNA; STD; PLN; 1029 BP.
KC190098;
Brassica napus mitogen-activated protein kinase kinase kinase 20.1 (MAPKKK20.1) mRNA, complete cds.

KC190099; SV 1; linear; mRNA; STD; PLN; 1686 BP.
KC190099;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK2.1 (ZIK2.1) mRNA, complete cds. FT                   NGMAKKVAFPFGIMNDTSVDVAMEMVKELEITDWDPVEIAEMIDGEISSLVPGWRYEEG

KC190100; SV 1; linear; mRNA; STD; PLN; 1701 BP.
KC190100;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK3.1 (ZIK3.1) mRNA, complete cds. FT                   YEGIEVAWNQVKLRNFTRNPEELEKFFREIHLLKTLNHQNIMKFYTSWVDTNNLAINFV

KC190101; SV 1; linear; mRNA; STD; PLN; 2037 BP.
KC190101;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK4.1 (ZIK4.1) mRNA, partial cds.

KC190102; SV 1; linear; mRNA; STD; PLN; 936 BP.
KC190102;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK8.1 (ZIK8.1) mRNA, complete cds.

KC190103; SV 1; linear; mRNA; STD; PLN; 1317 BP.
KC190103;
Brassica napus mitogen-activated protein kinase kinase kinase Raf17.1 (Raf17.1) mRNA, complete cds.

KC190104; SV 1; linear; mRNA; STD; PLN; 1230 BP.
KC190104;
Brassica napus mitogen-activated protein kinase kinase kinase Raf28.1 (Raf28.1) mRNA, complete cds.

KC190105; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KC190105;
Brassica napus mitogen-activated protein kinase kinase kinase Raf29.1 (Raf29.1) mRNA, complete cds.

KC190106; SV 1; linear; mRNA; STD; PLN; 1704 BP.
KC190106;
Brassica napus mitogen-activated protein kinase kinase kinase Raf30.1 (Raf30.1) mRNA, complete cds.

KC190107; SV 1; linear; mRNA; STD; PLN; 1059 BP.
KC190107;
Brassica napus mitogen-activated protein kinase kinase kinase Raf34.1 (Raf34.1) mRNA, complete cds.

KC190108; SV 1; linear; mRNA; STD; PLN; 3189 BP.
KC190108;
Brassica napus mitogen-activated protein kinase kinase kinase Raf35.1 (Raf35.1) mRNA, complete cds.

KC190109; SV 1; linear; mRNA; STD; PLN; 1530 BP.
KC190109;
Brassica napus mitogen-activated protein kinase kinase kinase Raf36.1 (Raf36.1) mRNA, partial cds. FT                   NGCLGARLEKQFTKEVTLLSRLSHPNVIKFVGAYKDPPSYCVLTEYLPEGSLRSYLHKP

KC190110; SV 1; linear; mRNA; STD; PLN; 1137 BP.
KC190110;
Brassica napus mitogen-activated protein kinase kinase kinase Raf39.1 (Raf39.1) mRNA, complete cds.

KC414027; SV 1; linear; mRNA; STD; PLN; 1318 BP.
KC414027;
Brassica napus CBL-interacting protein kinase 14 (CIPK14.1) mRNA, complete cds.

KC414028; SV 1; linear; mRNA; STD; PLN; 1368 BP.
KC414028;
Brassica napus CBL-interacting protein kinase 25 (CIPK25.1) mRNA, complete cds.

KC790460; SV 1; linear; mRNA; STD; PLN; 813 BP.
KC790460;
Brassica rapa cultivar rapid-cycling CrGC 1-33 plasma membrane localized sucrose transporter (SWEET9) mRNA, complete cds.

KC797141; SV 1; linear; genomic DNA; STD; PLN; 956 BP.
KC797141;
Brassica napus transcription factor subunit NF-YC1 (NF-YC1) gene, complete cds.

KC797142; SV 1; linear; genomic DNA; STD; PLN; 943 BP.
KC797142;
Brassica napus transcription factor subunit NF-YC2 (NF-YC2) gene, complete cds; kinetoplast.

KC797143; SV 1; linear; genomic DNA; STD; PLN; 1203 BP.
KC797143;
Brassica napus transcription factor subunit NF-YC4 (NF-YC4) gene, complete cds.

KC797144; SV 1; linear; genomic DNA; STD; PLN; 1364 BP.
KC797144;
Brassica napus transcription factor subunit NF-YC9A (NF-YC9A) gene, complete cds.

KC797145; SV 1; linear; genomic DNA; STD; PLN; 1333 BP.
KC797145;
Brassica napus transcription factor subunit NF-YC9B (NF-YC9B) gene, complete cds.

KC907717; SV 1; linear; genomic DNA; STD; PLN; 3676 BP.
KC907717;
Brassica rapa carotenoid isomerase 1 (CRTISO1) gene, complete cds.

KC907718; SV 1; linear; genomic DNA; STD; PLN; 3612 BP.
KC907718;
Brassica rapa carotenoid isomerase 1 (CRTISO1) gene, complete cds.

KF030503; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030503;
Brassica oleracea isolate 1-A fatty acid elongase 1 (FAE1) gene, partial cds.

KF030504; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030504;
Brassica oleracea var. botrytis isolate 1-B fatty acid elongase 1 (FAE1) gene, partial cds.

KF030505; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030505;
Brassica oleracea var. italica isolate 1-C fatty acid elongase 1 (FAE1) gene, partial cds.

KF030506; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030506;
Brassica oleracea var. gemmifera isolate 1-D fatty acid elongase 1 (FAE1) gene, partial cds.

KF030507; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030507;
Brassica oleracea var. gongylodes isolate 1-E fatty acid elongase 1 (FAE1) gene, partial cds.

KF030508; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030508;
Brassica oleracea var. albiflora isolate 1-F fatty acid elongase 1 (FAE1) gene, partial cds.

KF030509; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030509;
Brassica rapa isolate 1-G fatty acid elongase 1 (FAE1) gene, partial cds.

KF030512; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030512;
Brassica napus subsp. rapifera isolate 1-K fatty acid elongase 1 (FAE1) gene, partial cds.

KF129395; SV 1; linear; mRNA; STD; PLN; 2412 BP.
KF129395;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase CTR1 (CTR1) mRNA, complete cds.

KF129396; SV 1; linear; mRNA; STD; PLN; 1641 BP.
KF129396;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf21 (Raf21) mRNA, complete cds.

KF129397; SV 1; linear; mRNA; STD; PLN; 1227 BP.
KF129397;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf22 (Raf22) mRNA, complete cds.

KF129398; SV 1; linear; mRNA; STD; PLN; 1431 BP.
KF129398;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf23 (Raf23) mRNA, complete cds.

KF129399; SV 1; linear; mRNA; STD; PLN; 1380 BP.
KF129399;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf27 (Raf27) mRNA, complete cds.

KF129400; SV 1; linear; mRNA; STD; PLN; 1155 BP.
KF129400;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf33 (Raf33) mRNA, complete cds.

KF129401; SV 1; linear; mRNA; STD; PLN; 1197 BP.
KF129401;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf37 (Raf37) mRNA, complete cds.

KF129402; SV 1; linear; mRNA; STD; PLN; 1071 BP.
KF129402;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf41 (Raf41) mRNA, complete cds.

KF129403; SV 1; linear; mRNA; STD; PLN; 1377 BP.
KF129403;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf46 (Raf46) mRNA, complete cds.

KF129404; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KF129404;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK5 (ZIK5) mRNA, complete cds.

KF129405; SV 1; linear; mRNA; STD; PLN; 1665 BP.
KF129405;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK6 (ZIK6) mRNA, complete cds. FT                   VDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFNSWVDEKNKTINMI

KF129406; SV 1; linear; mRNA; STD; PLN; 1428 BP.
KF129406;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK9 (ZIK9) mRNA, complete cds. FT                   YEGIEVAWNQVKLYDFLQSPQELERLYCEIHLLKTLKHKSIMKFYTSWVDTDNRNINFI

KF169735; SV 1; linear; mRNA; STD; PLN; 1503 BP.
KF169735;
Brassica napus calcium-dependent protein kinase 4.1 (CPK4.1) mRNA, complete cds.

KF169736; SV 1; linear; mRNA; STD; PLN; 1503 BP.
KF169736;
Brassica napus calcium-dependent protein kinase 4.2 (CPK4.2) mRNA, complete cds.

KF169737; SV 1; linear; mRNA; STD; PLN; 1572 BP.
KF169737;
Brassica napus calcium-dependent protein kinase 17 (CPK17.1) mRNA, complete cds.

KF169738; SV 1; linear; mRNA; STD; PLN; 1626 BP.
KF169738;
Brassica napus calcium-dependent protein kinase 18 (CPK18.1) mRNA, complete cds.

KF169739; SV 1; linear; mRNA; STD; PLN; 1833 BP.
KF169739;
Brassica napus calcium-dependent protein kinase 24 (CPK24.1) mRNA, complete cds.

KF169740; SV 1; linear; mRNA; STD; PLN; 1641 BP.
KF169740;
Brassica napus calcium-dependent protein kinase 30 (CPK30.1) mRNA, complete cds.

KF169741; SV 1; linear; mRNA; STD; PLN; 1617 BP.
KF169741;
Brassica napus calcium-dependent protein kinase 32 (CPK32.1) mRNA, complete cds.

KF577723; SV 1; linear; mRNA; STD; PLN; 1281 BP.
KF577723;
Brassica oleracea var. capitata ABA insensitive 1 mRNA, complete cds.

KF856616; SV 1; linear; mRNA; STD; PLN; 799 BP.
KF856616;
UNVERIFIED: Brassica oleracea var. viridis MADS box protein-like (AGL11) mRNA, complete sequence.

KF913845; SV 1; linear; mRNA; STD; PLN; 1065 BP.
KF913845;
Brassica oleracea var. alboglabra chloroplast ascorbate peroxidase S mRNA, complete cds; nuclear gene for chloroplast product.

KF976447; SV 1; linear; genomic DNA; STD; PLN; 2899 BP.
KF976447;
Brassica napus isolate Reiyou1-88 heat shock protein 70-1 (HSP70-1) gene, complete cds. FT                   VEQMVQEAERFAKDDKEKREAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQ

KF999615; SV 1; linear; genomic DNA; STD; PLN; 3008 BP.
KF999615;
Brassica rapa isolate D1 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999616; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999616;
Brassica rapa isolate D2 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999617; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999617;
Brassica rapa isolate D3 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999618; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999618;
Brassica rapa isolate D4 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999619; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999619;
Brassica rapa isolate D5 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999620; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999620;
Brassica rapa isolate D6 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999621; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999621;
Brassica rapa isolate D7 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999622; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999622;
Brassica rapa isolate D8 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999623; SV 1; linear; genomic DNA; STD; PLN; 3044 BP.
KF999623;
Brassica rapa isolate D9 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999624; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999624;
Brassica rapa isolate D10 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999625; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999625;
Brassica rapa isolate D11 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999626; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999626;
Brassica rapa isolate D12 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999627; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999627;
Brassica rapa isolate D13 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999628; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999628;
Brassica rapa isolate D14 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999629; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999629;
Brassica rapa isolate D15 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999630; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999630;
Brassica rapa isolate D16 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999631; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999631;
Brassica rapa isolate D17 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999632; SV 1; linear; genomic DNA; STD; PLN; 3030 BP.
KF999632;
Brassica rapa isolate D18 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999633; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999633;
Brassica rapa isolate D19 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999634; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999634;
Brassica rapa isolate D20 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999635; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999635;
Brassica rapa isolate D21 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999636; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999636;
Brassica rapa isolate D22 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999637; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999637;
Brassica rapa isolate D23 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999638; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999638;
Brassica rapa isolate D24 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999639; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999639;
Brassica rapa isolate D25 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KJ173682; SV 1; linear; mRNA; STD; PLN; 1133 BP.
KJ173682;
Brassica rapa cultivar Tsuda annexin protein 3 mRNA, complete cds.

KJ173683; SV 1; linear; mRNA; STD; PLN; 1142 BP.
KJ173683;
Brassica rapa cultivar Tsuda annexin protein 4 mRNA, complete cds.

KJ173684; SV 1; linear; mRNA; STD; PLN; 1056 BP.
KJ173684;
Brassica rapa cultivar Tsuda aquaporin (PIP1b1) mRNA, complete cds.

KJ173685; SV 1; linear; mRNA; STD; PLN; 902 BP.
KJ173685;
Brassica rapa cultivar Tsuda plasma-membrane associated cation-binding protein 1 mRNA, complete cds.

KJ173686; SV 1; linear; mRNA; STD; PLN; 743 BP.
KJ173686;
Brassica rapa cultivar Tsuda peptidylprolyl isomerase (ROC1) mRNA, complete cds.

KJ173687; SV 1; linear; mRNA; STD; PLN; 799 BP.
KJ173687;
Brassica rapa cultivar Tsuda peptidylprolyl isomerase (ROC2) mRNA, complete cds.

KJ184845; SV 1; linear; mRNA; STD; PLN; 1143 BP.
KJ184845;
Brassica napus lysophosphatidyl acyltransferase 4-1 mRNA, complete cds.

KJ184846; SV 1; linear; mRNA; STD; PLN; 1140 BP.
KJ184846;
Brassica napus lysophosphatidyl acyltransferase 4-2 mRNA, complete cds.

KJ184847; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KJ184847;
Brassica napus lysophosphatidyl acyltransferase 5 mRNA, complete cds.

KJ508094; SV 1; linear; mRNA; STD; PLN; 657 BP.
KJ508094;
Brassica rapa subsp. chinensis ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (rbcs) mRNA, complete cds.

KJ508095; SV 1; linear; mRNA; STD; PLN; 1314 BP.
KJ508095;
Brassica rapa subsp. chinensis ribulose-1,5-bisphosphate carboxylase/oxygenase activase (RCA) mRNA, complete cds.

KJ508096; SV 1; linear; mRNA; STD; PLN; 1239 BP.
KJ508096;
Brassica rapa subsp. chinensis fructose-1,6-bisphosphatase (FBPase) mRNA, complete cds.


29/04/2014

KF856616; SV 1; linear; mRNA; STD; PLN; 799 BP.
KF856616;
UNVERIFIED: Brassica oleracea var. viridis MADS box protein-like (AGL11) mRNA, complete sequence.

KF921090; SV 1; linear; mRNA; STD; PLN; 1062 BP.
KF921090;
Brassica oleracea var. capitata bHLH transcription factor SPT mRNA, complete cds.

KF926983; SV 1; linear; genomic DNA; STD; PLN; 1296 BP.
KF926983;
Brassica rapa subsp. oleifera DFR1 gene, promoter region.

KF926984; SV 1; linear; genomic DNA; STD; PLN; 1297 BP.
KF926984;
Brassica rapa subsp. oleifera DFR2 gene, promoter region.

KF926985; SV 1; linear; genomic DNA; STD; PLN; 846 BP.
KF926985;
Brassica rapa subsp. oleifera F3'H1 gene, promoter region.

KF926986; SV 1; linear; genomic DNA; STD; PLN; 851 BP.
KF926986;
Brassica rapa subsp. oleifera F3'H2 gene, promoter region.

KJ130320; SV 1; linear; genomic DNA; STD; PLN; 842 BP.
KJ130320;
Brassica rapa subsp. pekinensis precursor microRNA miR319a2 gene, complete sequence.


7/3/2014

KJ508094; SV 1; linear; mRNA; STD; PLN; 657 BP.
KJ508094;
Brassica rapa subsp. chinensis ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (rbcs) mRNA, complete cds.

KJ508095; SV 1; linear; mRNA; STD; PLN; 1314 BP.
KJ508095;
Brassica rapa subsp. chinensis ribulose-1,5-bisphosphate carboxylase/oxygenase activase (RCA) mRNA, complete cds.

KJ508096; SV 1; linear; mRNA; STD; PLN; 1239 BP.
KJ508096;
Brassica rapa subsp. chinensis fructose-1,6-bisphosphatase (FBPase) mRNA, complete cds.

13/3/2014

KC190095; SV 1; linear; mRNA; STD; PLN; 1104 BP.
KC190095;
Brassica napus mitogen-activated protein kinase kinase kinase 17.1 (MAPKKK17.1) mRNA, complete cds.

KC190096; SV 1; linear; mRNA; STD; PLN; 1014 BP.
KC190096;
Brassica napus mitogen-activated protein kinase kinase kinase 18.1 (MAPKKK18.1) mRNA, complete cds.

KC190097; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KC190097;
Brassica napus mitogen-activated protein kinase kinase kinase 19.1 (MAPKKK19.1) mRNA, complete cds.

KC190098; SV 1; linear; mRNA; STD; PLN; 1029 BP.
KC190098;
Brassica napus mitogen-activated protein kinase kinase kinase 20.1 (MAPKKK20.1) mRNA, complete cds.

KC190099; SV 1; linear; mRNA; STD; PLN; 1686 BP.
KC190099;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK2.1 (ZIK2.1) mRNA, complete cds. FT                   NGMAKKVAFPFGIMNDTSVDVAMEMVKELEITDWDPVEIAEMIDGEISSLVPGWRYEEG

KC190100; SV 1; linear; mRNA; STD; PLN; 1701 BP.
KC190100;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK3.1 (ZIK3.1) mRNA, complete cds. FT                   YEGIEVAWNQVKLRNFTRNPEELEKFFREIHLLKTLNHQNIMKFYTSWVDTNNLAINFV

KC190101; SV 1; linear; mRNA; STD; PLN; 2037 BP.
KC190101;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK4.1 (ZIK4.1) mRNA, partial cds.

KC190102; SV 1; linear; mRNA; STD; PLN; 936 BP.
KC190102;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK8.1 (ZIK8.1) mRNA, complete cds.

KC190103; SV 1; linear; mRNA; STD; PLN; 1317 BP.
KC190103;
Brassica napus mitogen-activated protein kinase kinase kinase Raf17.1 (Raf17.1) mRNA, complete cds.

KC190104; SV 1; linear; mRNA; STD; PLN; 1230 BP.
KC190104;
Brassica napus mitogen-activated protein kinase kinase kinase Raf28.1 (Raf28.1) mRNA, complete cds.

KC190105; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KC190105;
Brassica napus mitogen-activated protein kinase kinase kinase Raf29.1 (Raf29.1) mRNA, complete cds.

KC190106; SV 1; linear; mRNA; STD; PLN; 1704 BP.
KC190106;
Brassica napus mitogen-activated protein kinase kinase kinase Raf30.1 (Raf30.1) mRNA, complete cds.

KC190107; SV 1; linear; mRNA; STD; PLN; 1059 BP.
KC190107;
Brassica napus mitogen-activated protein kinase kinase kinase Raf34.1 (Raf34.1) mRNA, complete cds.

KC190108; SV 1; linear; mRNA; STD; PLN; 3189 BP.
KC190108;
Brassica napus mitogen-activated protein kinase kinase kinase Raf35.1 (Raf35.1) mRNA, complete cds.

KC190109; SV 1; linear; mRNA; STD; PLN; 1530 BP.
KC190109;
Brassica napus mitogen-activated protein kinase kinase kinase Raf36.1 (Raf36.1) mRNA, partial cds. FT                   NGCLGARLEKQFTKEVTLLSRLSHPNVIKFVGAYKDPPSYCVLTEYLPEGSLRSYLHKP

KC190110; SV 1; linear; mRNA; STD; PLN; 1137 BP.
KC190110;
Brassica napus mitogen-activated protein kinase kinase kinase Raf39.1 (Raf39.1) mRNA, complete cds.


14/3/2014

KF976447; SV 1; linear; genomic DNA; STD; PLN; 2899 BP.
KF976447;
Brassica napus isolate Reiyou1-88 heat shock protein 70-1 (HSP70-1) gene, complete cds. FT                   VEQMVQEAERFAKDDKEKREAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQ

KJ013589; SV 1; linear; mRNA; STD; PLN; 645 BP.
KJ013589;
Brassica rapa subsp. chinensis CBF1 mRNA, complete cds.

KJ013590; SV 1; linear; mRNA; STD; PLN; 756 BP.
KJ013590;
Brassica rapa subsp. chinensis CBF2 mRNA, complete cds.

KJ013591; SV 1; linear; mRNA; STD; PLN; 825 BP.
KJ013591;
Brassica rapa subsp. chinensis CBF3 mRNA, complete cds.

KJ013592; SV 1; linear; mRNA; STD; PLN; 663 BP.
KJ013592;
Brassica rapa subsp. chinensis CBF4 mRNA, complete cds.

KJ013593; SV 1; linear; mRNA; STD; PLN; 558 BP.
KJ013593;
Brassica rapa subsp. chinensis CBF5 mRNA, complete cds.

KJ013594; SV 1; linear; mRNA; STD; PLN; 618 BP.
KJ013594;
Brassica rapa subsp. chinensis CBF6A mRNA, complete cds.

KJ013595; SV 1; linear; mRNA; STD; PLN; 621 BP.
KJ013595;
Brassica rapa subsp. chinensis CBF6B mRNA, complete cds.

KJ013596; SV 1; linear; mRNA; STD; PLN; 609 BP.
KJ013596;
Brassica rapa subsp. chinensis CBF6C mRNA, complete cds.

KJ013597; SV 1; linear; mRNA; STD; PLN; 1593 BP.
KJ013597;
Brassica rapa subsp. chinensis NRT2.2 mRNA, complete cds.


18/3/2014

KF129395; SV 1; linear; mRNA; STD; PLN; 2412 BP.
KF129395;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase CTR1 (CTR1) mRNA, complete cds.

KF129396; SV 1; linear; mRNA; STD; PLN; 1641 BP.
KF129396;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf21 (Raf21) mRNA, complete cds.

KF129397; SV 1; linear; mRNA; STD; PLN; 1227 BP.
KF129397;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf22 (Raf22) mRNA, complete cds.

KF129398; SV 1; linear; mRNA; STD; PLN; 1431 BP.
KF129398;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf23 (Raf23) mRNA, complete cds.

KF129399; SV 1; linear; mRNA; STD; PLN; 1380 BP.
KF129399;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf27 (Raf27) mRNA, complete cds.

KF129400; SV 1; linear; mRNA; STD; PLN; 1155 BP.
KF129400;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf33 (Raf33) mRNA, complete cds.

KF129401; SV 1; linear; mRNA; STD; PLN; 1197 BP.
KF129401;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf37 (Raf37) mRNA, complete cds.

KF129402; SV 1; linear; mRNA; STD; PLN; 1071 BP.
KF129402;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf41 (Raf41) mRNA, complete cds.

KF129403; SV 1; linear; mRNA; STD; PLN; 1377 BP.
KF129403;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase Raf46 (Raf46) mRNA, complete cds.

KF129404; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KF129404;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK5 (ZIK5) mRNA, complete cds.

KF129405; SV 1; linear; mRNA; STD; PLN; 1665 BP.
KF129405;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK6 (ZIK6) mRNA, complete cds. FT                   VDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFNSWVDEKNKTINMI

KF129406; SV 1; linear; mRNA; STD; PLN; 1428 BP.
KF129406;
Brassica napus cultivar DH12075 mitogen activated kinase kinase kinase ZIK9 (ZIK9) mRNA, complete cds. FT                   YEGIEVAWNQVKLYDFLQSPQELERLYCEIHLLKTLKHKSIMKFYTSWVDTDNRNINFI


19/3/2014

KF999615; SV 1; linear; genomic DNA; STD; PLN; 3008 BP.
KF999615;
Brassica rapa isolate D1 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999616; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999616;
Brassica rapa isolate D2 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999617; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999617;
Brassica rapa isolate D3 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999618; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999618;
Brassica rapa isolate D4 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999619; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999619;
Brassica rapa isolate D5 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999620; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999620;
Brassica rapa isolate D6 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999621; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999621;
Brassica rapa isolate D7 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999622; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999622;
Brassica rapa isolate D8 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999623; SV 1; linear; genomic DNA; STD; PLN; 3044 BP.
KF999623;
Brassica rapa isolate D9 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999624; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999624;
Brassica rapa isolate D10 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999625; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999625;
Brassica rapa isolate D11 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999626; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999626;
Brassica rapa isolate D12 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999627; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999627;
Brassica rapa isolate D13 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999628; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999628;
Brassica rapa isolate D14 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999629; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999629;
Brassica rapa isolate D15 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999630; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999630;
Brassica rapa isolate D16 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999631; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999631;
Brassica rapa isolate D17 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999632; SV 1; linear; genomic DNA; STD; PLN; 3030 BP.
KF999632;
Brassica rapa isolate D18 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999633; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999633;
Brassica rapa isolate D19 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999634; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999634;
Brassica rapa isolate D20 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999635; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999635;
Brassica rapa isolate D21 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999636; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999636;
Brassica rapa isolate D22 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999637; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999637;
Brassica rapa isolate D23 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999638; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999638;
Brassica rapa isolate D24 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KF999639; SV 1; linear; genomic DNA; STD; PLN; 1521 BP.
KF999639;
Brassica rapa isolate D25 fatty acid elongase 1 protein (FAE1) gene, complete cds.

KJ018628; SV 1; linear; mRNA; STD; PLN; 839 BP.
KJ018628;
Brassica rapa heat shock protein 22 (hsp22) mRNA, complete cds.

KJ018629; SV 1; linear; mRNA; STD; PLN; 1281 BP.
KJ018629;
Brassica rapa flavin-containing monooxygenase family protein (FMO) mRNA, complete cds.

KJ018630; SV 1; linear; mRNA; STD; PLN; 678 BP.
KJ018630;
Brassica rapa heat shock protein 18 (hsp18) mRNA, complete cds.

KJ018631; SV 1; linear; mRNA; STD; PLN; 1555 BP.
KJ018631;
Brassica rapa heat shock protein 90 (hsp90) mRNA, partial cds.

KJ018632; SV 1; linear; mRNA; STD; PLN; 539 BP.
KJ018632;
Brassica rapa heat shock protein 70 (hsp70) mRNA, partial cds.

KJ018633; SV 1; linear; mRNA; STD; PLN; 655 BP.
KJ018633;
Brassica rapa heat shock transcription factor (hsf) mRNA, partial cds.


25/3/2014

KC907717; SV 1; linear; genomic DNA; STD; PLN; 3676 BP.
KC907717;
Brassica rapa carotenoid isomerase 1 (CRTISO1) gene, complete cds.

KC907718; SV 1; linear; genomic DNA; STD; PLN; 3612 BP.
KC907718;
Brassica rapa carotenoid isomerase 1 (CRTISO1) gene, complete cds.

KF169735; SV 1; linear; mRNA; STD; PLN; 1503 BP.
KF169735;
Brassica napus calcium-dependent protein kinase 4.1 (CPK4.1) mRNA, complete cds.

KF169736; SV 1; linear; mRNA; STD; PLN; 1503 BP.
KF169736;
Brassica napus calcium-dependent protein kinase 4.2 (CPK4.2) mRNA, complete cds.

KF169737; SV 1; linear; mRNA; STD; PLN; 1572 BP.
KF169737;
Brassica napus calcium-dependent protein kinase 17 (CPK17.1) mRNA, complete cds.

KF169738; SV 1; linear; mRNA; STD; PLN; 1626 BP.
KF169738;
Brassica napus calcium-dependent protein kinase 18 (CPK18.1) mRNA, complete cds.

KF169739; SV 1; linear; mRNA; STD; PLN; 1833 BP.
KF169739;
Brassica napus calcium-dependent protein kinase 24 (CPK24.1) mRNA, complete cds.

KF169740; SV 1; linear; mRNA; STD; PLN; 1641 BP.
KF169740;
Brassica napus calcium-dependent protein kinase 30 (CPK30.1) mRNA, complete cds.

KF169741; SV 1; linear; mRNA; STD; PLN; 1617 BP.
KF169741;
Brassica napus calcium-dependent protein kinase 32 (CPK32.1) mRNA, complete cds.


27/3/2014

JX122892; SV 1; linear; mRNA; STD; PLN; 1089 BP.
JX122892;
Brassica napus ABA-responsive element binding factor 1 (ABF1.1) mRNA, complete cds.

JX122893; SV 1; linear; mRNA; STD; PLN; 1233 BP.
JX122893;
Brassica napus ABA-responsive element binding factor 3 (ABF3.1) mRNA, complete cds.

JX122894; SV 1; linear; mRNA; STD; PLN; 1188 BP.
JX122894;
Brassica napus ABA-responsive element binding factor 4 (ABF4.1) mRNA, complete cds.

JX122895; SV 1; linear; mRNA; STD; PLN; 1263 BP.
JX122895;
Brassica napus ABA insensitive PP2C protein 1 (ABI1.1) mRNA, complete cds.

JX122896; SV 1; linear; mRNA; STD; PLN; 1269 BP.
JX122896;
Brassica napus ABA insensitive PP2C protein 2 (ABI2.1) mRNA, complete cds.

JX122897; SV 1; linear; mRNA; STD; PLN; 1206 BP.
JX122897;
Brassica napus ABA hypersensitive PP2C protein AHG3/PP2CA (AHG3.1) mRNA, complete cds.

JX122898; SV 1; linear; mRNA; STD; PLN; 849 BP.
JX122898;
Brassica napus ABA-responsive element binding factor AREB3.1 (AREB3.1) mRNA, complete cds. FT                   LLKSVCSVETNQPPSMAVNEGLSRQGSLTLPRDLSKKTVEEVWKDIQQDKNGGGSGHER

JX122899; SV 1; linear; mRNA; STD; PLN; 837 BP.
JX122899;
Brassica napus ABA-responsive element binding factor AREB3.2 (AREB3.2) mRNA, complete cds. FT                   LLKSVCSVEGNQPSSLAAHEGLSRQGSLTFPRDLSKKTVEEVWKDIQQDKNGGGSGHER

JX122900; SV 1; linear; mRNA; STD; PLN; 1632 BP.
JX122900;
Brassica napus calcium-dependent protein kinase 10 (CPK10.1) mRNA, complete cds. FT                   LREALTDELGEPDVSVLNDIMREVDSDKDGRINYDEFVTMMKAGTDWRKASRQYSRERF

JX122901; SV 1; linear; mRNA; STD; PLN; 1494 BP.
JX122901;
Brassica napus calcium-dependent protein kinase 11 (CPK11.1) mRNA, complete cds.

JX122902; SV 1; linear; mRNA; STD; PLN; 1493 BP.
JX122902;
Brassica napus calcium-dependent protein kinase 12 (CPK12.1) mRNA, complete cds.

JX122903; SV 1; linear; mRNA; STD; PLN; 1587 BP.
JX122903;
Brassica napus calcium-dependent protein kinase 13 (CPK13.1) mRNA, complete cds.

JX122904; SV 1; linear; mRNA; STD; PLN; 1711 BP.
JX122904;
Brassica napus calcium-dependent protein kinase 15 (CPK15.1) mRNA, partial cds.

JX122905; SV 1; linear; mRNA; STD; PLN; 1788 BP.
JX122905;
Brassica napus calcium-dependent protein kinase 1 (CPK1.1) mRNA, complete cds.

JX122906; SV 1; linear; mRNA; STD; PLN; 1854 BP.
JX122906;
Brassica napus calcium-dependent protein kinase 2 (CPK2.1) mRNA, complete cds.

JX122907; SV 1; linear; mRNA; STD; PLN; 1578 BP.
JX122907;
Brassica napus calcium-dependent protein kinase 21 (CPK2.1) mRNA, complete cds.

JX122908; SV 1; linear; mRNA; STD; PLN; 1617 BP.
JX122908;
Brassica napus calcium-dependent protein kinase 29 (CPK2.1) mRNA, complete cds.

JX122909; SV 1; linear; mRNA; STD; PLN; 1623 BP.
JX122909;
Brassica napus calcium-dependent protein kinase 28 (CPK28.1) mRNA, complete cds.

JX122910; SV 1; linear; mRNA; STD; PLN; 1575 BP.
JX122910;
Brassica napus calcium-dependent protein kinase 3 (CPK3.1) mRNA, partial cds.

JX122911; SV 1; linear; mRNA; STD; PLN; 1635 BP.
JX122911;
Brassica napus calcium-dependent protein kinase 5 (CPK5.1) mRNA, partial cds.

JX122912; SV 1; linear; mRNA; STD; PLN; 1647 BP.
JX122912;
Brassica napus calcium-dependent protein kinase 6 (CPK6.1) mRNA, complete cds.

JX122913; SV 1; linear; mRNA; STD; PLN; 1599 BP.
JX122913;
Brassica napus calcium-dependent protein kinase 7 (CPK7.1) mRNA, complete cds.

JX122914; SV 1; linear; mRNA; STD; PLN; 1602 BP.
JX122914;
Brassica napus calcium-dependent protein kinase 8 (CPK8.1) mRNA, partial cds.

JX122915; SV 1; linear; mRNA; STD; PLN; 1617 BP.
JX122915;
Brassica napus calcium-dependent protein kinase 9 (CPK9.1) mRNA, partial cds.

JX122916; SV 1; linear; mRNA; STD; PLN; 1455 BP.
JX122916;
Brassica napus hypersensitive to ABA 1 (HAB1.1) mRNA, complete cds.

JX122917; SV 1; linear; mRNA; STD; PLN; 1539 BP.
JX122917;
Brassica napus hypersensitive to ABA 2 (HAB1.1) mRNA, complete cds.

JX944041; SV 1; linear; mRNA; STD; PLN; 1627 BP.
JX944041;
Brassica oleracea clone BoRCA1 chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase activase precursor protein mRNA, complete cds; nuclear gene for chloroplast product.

JX944042; SV 1; linear; mRNA; STD; PLN; 1640 BP.
JX944042;
Brassica oleracea clone BoRCA2 chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase activase precursor protein mRNA, complete cds; nuclear gene for chloroplast product.

KC414029; SV 1; linear; mRNA; STD; PLN; 1317 BP.
KC414029;
Brassica napus ABA insensitive PP2C protein 5 (ABI5.1) mRNA, complete cds.

KC414030; SV 1; linear; mRNA; STD; PLN; 1455 BP.
KC414030;
Brassica napus calcium-dependent protein kinase 34 (CPK34.1) mRNA, complete cds.

KC984300; SV 2; linear; mRNA; STD; PLN; 1163 BP.
KC984300;
Brassica oleracea var. viridis AG mRNA, complete cds.

KC984301; SV 2; linear; mRNA; STD; PLN; 999 BP.
KC984301;
Brassica oleracea var. viridis AGL6 mRNA, complete cds.

KC984302; SV 2; linear; mRNA; STD; PLN; 1086 BP.
KC984302;
Brassica oleracea var. viridis AGL12 mRNA, complete cds.

KC984303; SV 2; linear; mRNA; STD; PLN; 1191 BP.
KC984303;
Brassica oleracea var. viridis AGL20 mRNA, complete cds.


KJ000117; SV 1; linear; mRNA; STD; PLN; 1647 BP.
KJ000117;
Brassica napus cultivar Xiangyou 15 sn-glycerol-3-phosphate acyltransferase 6-like protein mRNA, complete cds.


KF365484; SV 1; linear; mRNA; STD; PLN; 1257 BP.
KF365484;
Brassica napus AHG1.1 (AHG1.1) mRNA, complete cds.

KF365485; SV 1; linear; mRNA; STD; PLN; 1311 BP.
KF365485;
Brassica napus HAI2.1 (HAI2.1) mRNA, complete cds.

KF365486; SV 1; linear; mRNA; STD; PLN; 1266 BP.
KF365486;
Brassica napus HAI2.2 (HAI2.2) mRNA, complete cds.

KF365487; SV 1; linear; mRNA; STD; PLN; 1101 BP.
KF365487;
Brassica napus HAI3.1 (HAI3.1) mRNA, complete cds.

KF974743; SV 1; linear; mRNA; STD; PLN; 1854 BP.
KF974743;
Brassica napus CPK2-2.1 (CPK2-2.1) mRNA, complete cds.

KF974744; SV 1; linear; mRNA; STD; PLN; 1584 BP.
KF974744;
Brassica napus CPK3-2.1 (CPK3-2.1) mRNA, complete cds.

KF974745; SV 1; linear; mRNA; STD; PLN; 1635 BP.
KF974745;
Brassica napus CPK5-2.1 (CPK5-2.1) mRNA, complete cds.

KF974746; SV 1; linear; mRNA; STD; PLN; 1605 BP.
KF974746;
Brassica napus CPK8-2.1 (CPK8-2.1) mRNA, complete cds.

KF974747; SV 1; linear; mRNA; STD; PLN; 1635 BP.
KF974747;
Brassica napus CPK10-2.1 (CPK10-2.1) mRNA, complete cds.

KF974748; SV 1; linear; mRNA; STD; PLN; 1587 BP.
KF974748;
Brassica napus CPK13-2.1 (CPK13-2.1) mRNA, complete cds.

KF974749; SV 1; linear; mRNA; STD; PLN; 1176 BP.
KF974749;
Brassica napus ABF4-2.1 (ABF4-2.1) mRNA, complete cds.


3/4/2014

KJ143523; SV 1; linear; mRNA; STD; PLN; 1161 BP.
KJ143523;
Brassica rapa subsp. rapa annexin 1 mRNA, complete cds.

KJ143524; SV 1; linear; mRNA; STD; PLN; 1105 BP.
KJ143524;
Brassica rapa subsp. rapa annexin 2 mRNA, complete cds.


5/4/2014

AB098076; SV 1; linear; genomic DNA; STD; PLN; 1035 BP.
AB098076;
Brassica napus 22a1 gene for promoter sequence.

AB836663; SV 1; linear; mRNA; STD; PLN; 633 BP.
AB836663;
Brassica napus 22a1 mRNA for BnENODL4, complete cds.

6/4/2014

KJ173682; SV 1; linear; mRNA; STD; PLN; 1133 BP.
KJ173682;
Brassica rapa cultivar Tsuda annexin protein 3 mRNA, complete cds.

KJ173683; SV 1; linear; mRNA; STD; PLN; 1142 BP.
KJ173683;
Brassica rapa cultivar Tsuda annexin protein 4 mRNA, complete cds.

KJ173684; SV 1; linear; mRNA; STD; PLN; 1056 BP.
KJ173684;
Brassica rapa cultivar Tsuda aquaporin (PIP1b1) mRNA, complete cds.

>J173685; SV 1; linear; mRNA; STD; PLN; 902 BP.
KJ173685;
Brassica rapa cultivar Tsuda plasma-membrane associated cation-binding protein 1 mRNA, complete cds.

KJ173686; SV 1; linear; mRNA; STD; PLN; 743 BP.
KJ173686;
Brassica rapa cultivar Tsuda peptidylprolyl isomerase (ROC1) mRNA, complete cds.

KJ173687; SV 1; linear; mRNA; STD; PLN; 799 BP.
KJ173687;
Brassica rapa cultivar Tsuda peptidylprolyl isomerase (ROC2) mRNA, complete cds.


10/4/2014

JN039346; SV 1; linear; mRNA; STD; PLN; 1417 BP.
JN039346;
Brassica rapa subsp. chinensis cultivar Suzhouqing mannose-6-phosphate isomerase-like protein (PMI2) mRNA, complete cds.

JX971618; SV 1; linear; mRNA; STD; PLN; 1016 BP.
JX971618;
Brassica oleracea cultivar Gold Acer male sterility related AT-hook DNA binding protein (MF2) mRNA, complete cds.

KJ184845; SV 1; linear; mRNA; STD; PLN; 1143 BP.
KJ184845;
Brassica napus lysophosphatidyl acyltransferase 4-1 mRNA, complete cds.

KJ184846; SV 1; linear; mRNA; STD; PLN; 1140 BP.
KJ184846;
Brassica napus lysophosphatidyl acyltransferase 4-2 mRNA, complete cds.

KJ184847; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KJ184847;
Brassica napus lysophosphatidyl acyltransferase 5 mRNA, complete cds.


11/4/2014

KC896379; SV 1; linear; mRNA; STD; PLN; 543 BP.
KC896379;
Brassica napus cultivar Longyou 9S autophagy-related protein 8a (Atg8a) mRNA, complete cds.

KC896382; SV 1; linear; genomic DNA; STD; PLN; 831 BP.
KC896382;
Brassica napus cultivar Longyou 9S autophagy-related protein 8a (Atg8a) gene, complete cds, alternatively spliced.

KC896383; SV 1; linear; genomic DNA; STD; PLN; 948 BP.
KC896383;
Brassica napus cultivar Longyou 9S autophagy-related protein 8b (Atg8b) gene, complete cds, alternatively spliced.

14/4/2014

KJ144191; SV 1; linear; mRNA; STD; PLN; 816 BP.
KJ144191;
Brassica rapa subsp. chinensis MYB transcription factor (MYB) mRNA, complete cds.

KJ144192; SV 1; linear; mRNA; STD; PLN; 1125 BP.
KJ144192;
Brassica rapa subsp. chinensis ATP synthase gamma chain mRNA, complete cds.

KJ144193; SV 1; linear; mRNA; STD; PLN; 1527 BP.
KJ144193;
Brassica rapa subsp. chinensis calmodulin-binding protein-like protein 1 mRNA, complete cds.

KJ144194; SV 1; linear; mRNA; STD; PLN; 618 BP.
KJ144194;
Brassica rapa subsp. chinensis calmodulin-binding protein-like protein 2 mRNA, complete cds.

KJ144195; SV 1; linear; mRNA; STD; PLN; 2256 BP.
KJ144195;
Brassica rapa subsp. chinensis DEAD-box ATP-dependent RNA helicase 3 mRNA, complete cds.

KJ144196; SV 1; linear; mRNA; STD; PLN; 1182 BP.
KJ144196;
Brassica rapa subsp. chinensis cytochrome b mRNA, complete cds; mitochondrial.


16/4/2014

KC790460; SV 1; linear; mRNA; STD; PLN; 813 BP.
KC790460;
Brassica rapa cultivar rapid-cycling CrGC 1-33 plasma membrane localized sucrose transporter (SWEET9) mRNA, complete cds.


26/02/2014

JQ911379; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911379;
Brassica napus voucher BGV UPM 399075 psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911384; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911384;
Brassica oleracea var. alboglabra voucher BGV UPM 2862 psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911385; SV 1; linear; genomic DNA; STD; PLN; 724 BP.
JQ911385;
Brassica oleracea var. gemmifera psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911386; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911386;
Brassica oleracea var. gemmifera voucher TA449 (MO, UMO) psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911387; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911387;
Brassica oleracea var. gongylodes voucher TA460 (MO, UMO) psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911388; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911388;
Brassica oleracea voucher TA432 (MO, UMO) psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911391; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911391;
Brassica rapa voucher IMB 218 psbD-trnT intergenic spacer, partial sequence; chloroplast.

JQ911502; SV 1; linear; genomic DNA; STD; PLN; 723 BP.
JQ911502;
Brassica rapa subsp. chinensis voucher BGV UPM 126370 psbD-trnT intergenic spacer, partial sequence; chloroplast.

KC797141; SV 1; linear; genomic DNA; STD; PLN; 956 BP.
KC797141;
Brassica napus transcription factor subunit NF-YC1 (NF-YC1) gene, complete cds.

KC797142; SV 1; linear; genomic DNA; STD; PLN; 943 BP.
KC797142;
Brassica napus transcription factor subunit NF-YC2 (NF-YC2) gene, complete cds; kinetoplast.

KC797143; SV 1; linear; genomic DNA; STD; PLN; 1203 BP.
KC797143;
Brassica napus transcription factor subunit NF-YC4 (NF-YC4) gene, complete cds.

KC797144; SV 1; linear; genomic DNA; STD; PLN; 1364 BP.
KC797144;
Brassica napus transcription factor subunit NF-YC9A (NF-YC9A) gene, complete cds.

KC797145; SV 1; linear; genomic DNA; STD; PLN; 1333 BP.
KC797145;
Brassica napus transcription factor subunit NF-YC9B (NF-YC9B) gene, complete cds.


20/02/2014

KF906142; SV 1; linear; genomic DNA; STD; PLN; 746 BP.
KF906142;
Brassica napus cultivar DY03 HRa gene, complete cds.

KF913845; SV 1; linear; mRNA; STD; PLN; 1065 BP.
KF913845;
Brassica oleracea var. alboglabra chloroplast ascorbate peroxidase S mRNA, complete cds; nuclear gene for chloroplast product.


19/02/2014

KF913845; SV 1; linear; mRNA; STD; PLN; 1065 BP.
KF913845;
Brassica oleracea var. alboglabra chloroplast ascorbate peroxidase S mRNA, complete cds; nuclear gene for chloroplast product.


18/02/2014

KC787659;
Brassica napus CAAT-box DNA binding protein subunit B1 (NF-YB1) gene, complete cds.

KC787660; SV 1; linear; genomic DNA; STD; PLN; 837 BP.
KC787660;
Brassica napus transcription factor subunit NF-YB2A (NF-YB2A) gene, complete cds.

KC787661; SV 1; linear; genomic DNA; STD; PLN; 739 BP.
KC787661;
Brassica napus transcription factor subunit NF-YB2B (NF-YB2B) gene, complete cds.

KC787662; SV 1; linear; genomic DNA; STD; PLN; 732 BP.
KC787662;
Brassica napus transcription factor subunit NF-YB3A (NF-YB3A) gene, complete cds.

KC787663; SV 1; linear; genomic DNA; STD; PLN; 520 BP.
KC787663;
Brassica napus transcription factor subunit NF-YB3B (NF-YB3B) gene, complete cds.

KC787664; SV 1; linear; genomic DNA; STD; PLN; 590 BP.
KC787664;
Brassica napus transcription factor subunit NF-YB3C (NF-YB3C) gene, complete cds.

KC787665; SV 1; linear; genomic DNA; STD; PLN; 618 BP.
KC787665;
Brassica napus transcription factor subunit NF-YB5 (NF-YB5) gene, complete cds.

KC787666; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KC787666;
Brassica napus transcription factor subunit NF-YB6A (NF-YB6A) gene, complete cds.

KC787667; SV 1; linear; genomic DNA; STD; PLN; 791 BP.
KC787667;
Brassica napus transcription factor subunit NF-YB6B (NF-YB6B) gene, complete cds.

KC787668; SV 1; linear; genomic DNA; STD; PLN; 651 BP.
KC787668;
Brassica napus transcription factor subunit NF-YB7A (NF-YB7A) gene, complete cds.

KC787669; SV 1; linear; genomic DNA; STD; PLN; 632 BP.
KC787669;
Brassica napus transcription factor subunit NF-YB7B (NF-YB7B) gene, complete cds.

KC787670; SV 1; linear; genomic DNA; STD; PLN; 1609 BP.
KC787670;
Brassica napus transcription factor subunit NF-YB8 (NF-YB8) gene, complete cds.

KC787671; SV 1; linear; genomic DNA; STD; PLN; 1997 BP.
KC787671;
Brassica napus transcription factor subunit NF-YB9 (NF-YB9) gene, complete cds.

KC787672; SV 1; linear; genomic DNA; STD; PLN; 1403 BP.
KC787672;
Brassica napus transcription factor subunit NF-YB10 (NF-YB1) gene, complete cds.

KC787677; SV 1; linear; genomic DNA; STD; PLN; 2060 BP.
KC787677;
Brassica napus transcription factor subunit NF-YA1A (NF-YA1A) gene, complete cds.

KC787678; SV 1; linear; genomic DNA; STD; PLN; 1473 BP.
KC787678;
Brassica napus transcription factor subunit NF-YA1B (NF-YA1B) gene, complete cds.

KC787679; SV 1; linear; genomic DNA; STD; PLN; 1502 BP.
KC787679;
Brassica napus transcription factor subunit NF-YA2 (NF-YA2) gene, complete cds.

KC787680; SV 1; linear; genomic DNA; STD; PLN; 2159 BP.
KC787680;
Brassica napus transcription factor subunit NF-YA3A.1 (NF-YA3A.1) gene, complete cds.

KC787681; SV 1; linear; genomic DNA; STD; PLN; 2159 BP.
KC787681;
Brassica napus transcription factor subunit NF-YA3A.2 (NF-YA3A.2) gene, complete cds.

KC787682; SV 1; linear; genomic DNA; STD; PLN; 1680 BP.
KC787682;
Brassica napus transcription factor subunit NF-YA4 (NF-YA4) gene, complete cds.

KC787683; SV 1; linear; genomic DNA; STD; PLN; 1825 BP.
KC787683;
Brassica napus transcription factor subunit NF-YA5A (NF-YA5A) gene, complete cds.

KC787684; SV 1; linear; genomic DNA; STD; PLN; 1719 BP.
KC787684;
Brassica napus transcription factor subunit NF-YA5B (NF-YA5B) gene, complete cds.

KC787685; SV 1; linear; genomic DNA; STD; PLN; 1455 BP.
KC787685;
Brassica napus transcription factor subunit NF-YA7 (NF-YA7) gene, complete cds.

KC787686; SV 1; linear; genomic DNA; STD; PLN; 1594 BP.
KC787686;
Brassica napus transcription factor subunit NF-YA9A (NF-YA9A) gene, complete cds.

KC787687; SV 1; linear; genomic DNA; STD; PLN; 1189 BP.
KC787687;
Brassica napus transcription factor subunit NF-YA10.1 (NF-YA10.1) gene, complete cds.

KC787688; SV 1; linear; genomic DNA; STD; PLN; 1189 BP.
KC787688;
Brassica napus transcription factor subunit NF-YA10.2 (NF-YA10.2) gene, complete cds.

KC800633; SV 1; linear; genomic DNA; STD; PLN; 1350 BP.
KC800633;
Brassica napus transcription factor subunit NF-YA3B (NF-YA3B) gene, complete cds.

KC818621; SV 1; linear; genomic DNA; STD; PLN; 1614 BP.
KC818621;
Brassica napus transcription factor subunit NF-YA9B (NF-YA9B) gene, complete cds.


14/02/2014

GR312927; SV 1; linear; mRNA; EST; PLN; 650 BP.
GR312927;
BoBFysx301 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312928; SV 1; linear; mRNA; EST; PLN; 216 BP.
GR312928;
BoBFysx304 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312929; SV 1; linear; mRNA; EST; PLN; 802 BP.
GR312929;
BoBFysx305 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312930; SV 1; linear; mRNA; EST; PLN; 582 BP.
GR312930;
BoBFysx308 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312931; SV 1; linear; mRNA; EST; PLN; 437 BP.
GR312931;
BoBFysx309 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312932; SV 1; linear; mRNA; EST; PLN; 1034 BP.
GR312932;
BoBFysx310 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312933; SV 1; linear; mRNA; EST; PLN; 384 BP.
GR312933;
BoBFysx313 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312934; SV 1; linear; mRNA; EST; PLN; 635 BP.
GR312934;
BoBFysx316 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312935; SV 1; linear; mRNA; EST; PLN; 1047 BP.
GR312935;
BoBFysx318 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312936; SV 1; linear; mRNA; EST; PLN; 295 BP.
GR312936;
BoBFysx319 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312937; SV 1; linear; mRNA; EST; PLN; 501 BP.
GR312937;
BoBFysx320 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312938; SV 1; linear; mRNA; EST; PLN; 492 BP.
GR312938;
BoBFysx325 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.

GR312939; SV 1; linear; mRNA; EST; PLN; 447 BP.
GR312939;
BoBFysx326 Brassica oleracea var. italica microspore Library (3'RACE) Brassica oleracea var. italica cDNA 3', mRNA sequence.


11/02/2014

JK789863; SV 1; linear; mRNA; EST; PLN; 341 BP.
JK789863;
PbrC027 Canola SSH cDNA library Brassica napus cDNA, mRNA sequence.

JK789864; SV 1; linear; mRNA; EST; PLN; 603 BP.
JK789864;
PbrC050 Canola SSH cDNA library Brassica napus cDNA, mRNA sequence.

JK789865; SV 1; linear; mRNA; EST; PLN; 452 BP.
JK789865;
PbrC082 Canola SSH cDNA library Brassica napus cDNA, mRNA sequence.

JK789866; SV 1; linear; mRNA; EST; PLN; 335 BP.
JK789866;
PbrS067 Canola SSH cDNA library Brassica napus cDNA, mRNA sequence.

JK789867; SV 1; linear; mRNA; EST; PLN; 595 BP.
JK789867;
PbrS078 Canola SSH cDNA library Brassica napus cDNA, mRNA sequence.

JK789868; SV 1; linear; mRNA; EST; PLN; 313 BP.
JK789868;
PbrS150 Canola SSH cDNA library Brassica napus cDNA, mRNA sequence.

JK789869; SV 1; linear; mRNA; EST; PLN; 473 BP.
JK789869;
PbrS820 Canola SSH cDNA library Brassica napus cDNA, mRNA sequence.


06/02/2014

GR301387; SV 1; linear; mRNA; EST; PLN; 236 BP.
GR301387;
BoBF1 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301388; SV 1; linear; mRNA; EST; PLN; 143 BP.
GR301388;
BoBF2 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301389; SV 1; linear; mRNA; EST; PLN; 188 BP.
GR301389;
BoBF3 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301390; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301390;
BoBF4 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301391; SV 1; linear; mRNA; EST; PLN; 135 BP.
GR301391;
BoBF5 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301392; SV 1; linear; mRNA; EST; PLN; 91 BP.
GR301392;
BoBF6 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301393; SV 1; linear; mRNA; EST; PLN; 84 BP.
GR301393;
BoBF7 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301394; SV 1; linear; mRNA; EST; PLN; 213 BP.
GR301394;
BoBF8 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301395; SV 1; linear; mRNA; EST; PLN; 311 BP.
GR301395;
BoBF9 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301396; SV 1; linear; mRNA; EST; PLN; 310 BP.
GR301396;
BoBF10 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301397; SV 1; linear; mRNA; EST; PLN; 177 BP.
GR301397;
BoBF11 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301398; SV 1; linear; mRNA; EST; PLN; 176 BP.
GR301398;
BoBF12 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301399; SV 1; linear; mRNA; EST; PLN; 186 BP.
GR301399;
BoBF13 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301400; SV 1; linear; mRNA; EST; PLN; 128 BP.
GR301400;
BoBF14 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301401; SV 1; linear; mRNA; EST; PLN; 127 BP.
GR301401;
BoBF15 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301402; SV 1; linear; mRNA; EST; PLN; 181 BP.
GR301402;
BoBF16 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301403; SV 1; linear; mRNA; EST; PLN; 101 BP.
GR301403;
BoBF17 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301404; SV 1; linear; mRNA; EST; PLN; 105 BP.
GR301404;
BoBF18 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301405; SV 1; linear; mRNA; EST; PLN; 98 BP.
GR301405;
BoBF19 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301406; SV 1; linear; mRNA; EST; PLN; 320 BP.
GR301406;
BoBF20 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301407; SV 1; linear; mRNA; EST; PLN; 109 BP.
GR301407;
BoBF21 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301408; SV 1; linear; mRNA; EST; PLN; 108 BP.
GR301408;
BoBF22 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301409; SV 1; linear; mRNA; EST; PLN; 99 BP.
GR301409;
BoBF23 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301410; SV 1; linear; mRNA; EST; PLN; 129 BP.
GR301410;
BoBF24 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA, mRNA sequence.

GR301411; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301411;
BoBF25 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301412; SV 1; linear; mRNA; EST; PLN; 78 BP.
GR301412;
BoBF26 Brassica oleracea var. italica microspore Library Brassica oleracea var. italica cDNA 5', mRNA sequence.

GR301413; SV 1; linear; mRNA; EST; PLN; 236 BP.
GR301413;
BoCF1 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301414; SV 1; linear; mRNA; EST; PLN; 143 BP.
GR301414;
BoCF2 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301415; SV 1; linear; mRNA; EST; PLN; 188 BP.
GR301415;
BoCF3 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301416; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301416;
BoCF4 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301417; SV 1; linear; mRNA; EST; PLN; 135 BP.
GR301417;
BoCF5 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301418; SV 1; linear; mRNA; EST; PLN; 91 BP.
GR301418;
BoCF6 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301419; SV 1; linear; mRNA; EST; PLN; 84 BP.
GR301419;
BoCF7 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301420; SV 1; linear; mRNA; EST; PLN; 213 BP.
GR301420;
BoCF8 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301421; SV 1; linear; mRNA; EST; PLN; 177 BP.
GR301421;
BoCF11 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301422; SV 1; linear; mRNA; EST; PLN; 176 BP.
GR301422;
BoCF12 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301423; SV 1; linear; mRNA; EST; PLN; 186 BP.
GR301423;
BoCF13 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301424; SV 1; linear; mRNA; EST; PLN; 128 BP.
GR301424;
BoCF14 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301425; SV 1; linear; mRNA; EST; PLN; 127 BP.
GR301425;
BoCF15 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301426; SV 1; linear; mRNA; EST; PLN; 181 BP.
GR301426;
BoCF16 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301427; SV 1; linear; mRNA; EST; PLN; 101 BP.
GR301427;
BoCF17 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301428; SV 1; linear; mRNA; EST; PLN; 105 BP.
GR301428;
BoCF18 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301429; SV 1; linear; mRNA; EST; PLN; 98 BP.
GR301429;
BoCF19 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301430; SV 1; linear; mRNA; EST; PLN; 320 BP.
GR301430;
BoCF20 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301431; SV 1; linear; mRNA; EST; PLN; 109 BP.
GR301431;
BoCF21 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301432; SV 1; linear; mRNA; EST; PLN; 108 BP.
GR301432;
BoCF22 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301433; SV 1; linear; mRNA; EST; PLN; 99 BP.
GR301433;
BoCF23 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301434; SV 1; linear; mRNA; EST; PLN; 129 BP.
GR301434;
BoCF24 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA, mRNA sequence.

GR301435; SV 1; linear; mRNA; EST; PLN; 179 BP.
GR301435;
BoCF25 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

GR301436; SV 1; linear; mRNA; EST; PLN; 78 BP.
GR301436;
BoCF26 Brassica oleracea var. capitata microspore Library Brassica oleracea var. capitata cDNA 5', mRNA sequence.

JZ469210; SV 1; linear; mRNA; EST; PLN; 474 BP.
JZ469210;
CCPd_EST_1 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469211; SV 1; linear; mRNA; EST; PLN; 104 BP.
JZ469211;
CCPd_EST_10 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469212; SV 1; linear; mRNA; EST; PLN; 223 BP.
JZ469212;
CCPd_EST_100 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469213; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469213;
CCPd_EST_1000 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469214; SV 1; linear; mRNA; EST; PLN; 141 BP.
JZ469214;
CCPd_EST_1002 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469215; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ469215;
CCPd_EST_1003 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469216; SV 1; linear; mRNA; EST; PLN; 335 BP.
JZ469216;
CCPd_EST_1005 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469217; SV 1; linear; mRNA; EST; PLN; 142 BP.
JZ469217;
CCPd_EST_1006 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469218; SV 1; linear; mRNA; EST; PLN; 414 BP.
JZ469218;
CCPd_EST_1007 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469219; SV 1; linear; mRNA; EST; PLN; 563 BP.
JZ469219;
CCPd_EST_1008 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469220; SV 1; linear; mRNA; EST; PLN; 181 BP.
JZ469220;
CCPd_EST_1009 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469221; SV 1; linear; mRNA; EST; PLN; 216 BP.
JZ469221;
CCPd_EST_101 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469222; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469222;
CCPd_EST_1010 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469223; SV 1; linear; mRNA; EST; PLN; 319 BP.
JZ469223;
CCPd_EST_1011 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469224; SV 1; linear; mRNA; EST; PLN; 320 BP.
JZ469224;
CCPd_EST_1012 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469225; SV 1; linear; mRNA; EST; PLN; 233 BP.
JZ469225;
CCPd_EST_1013 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469226; SV 1; linear; mRNA; EST; PLN; 286 BP.
JZ469226;
CCPd_EST_1016 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469227; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469227;
CCPd_EST_1018 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469228; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469228;
CCPd_EST_1021 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469229; SV 1; linear; mRNA; EST; PLN; 519 BP.
JZ469229;
CCPd_EST_1026 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469230; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469230;
CCPd_EST_1028 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469231; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469231;
CCPd_EST_1029 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469232; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469232;
CCPd_EST_1030 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469233; SV 1; linear; mRNA; EST; PLN; 456 BP.
JZ469233;
CCPd_EST_1031 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469234; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469234;
CCPd_EST_1032 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469235; SV 1; linear; mRNA; EST; PLN; 479 BP.
JZ469235;
CCPd_EST_1033 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469236; SV 1; linear; mRNA; EST; PLN; 570 BP.
JZ469236;
CCPd_EST_1034 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469237; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469237;
CCPd_EST_1036 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469238; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469238;
CCPd_EST_1037 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469239; SV 1; linear; mRNA; EST; PLN; 330 BP.
JZ469239;
CCPd_EST_1038 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469240; SV 1; linear; mRNA; EST; PLN; 722 BP.
JZ469240;
CCPd_EST_1039 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469241; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469241;
CCPd_EST_104 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469242; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469242;
CCPd_EST_1040 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469243; SV 1; linear; mRNA; EST; PLN; 711 BP.
JZ469243;
CCPd_EST_1041 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469244; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469244;
CCPd_EST_1043 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469245; SV 1; linear; mRNA; EST; PLN; 524 BP.
JZ469245;
CCPd_EST_1044 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469246; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469246;
CCPd_EST_1045 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469247; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469247;
CCPd_EST_1046 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469248; SV 1; linear; mRNA; EST; PLN; 648 BP.
JZ469248;
CCPd_EST_1047 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469249; SV 1; linear; mRNA; EST; PLN; 501 BP.
JZ469249;
CCPd_EST_1048 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469250; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469250;
CCPd_EST_1049 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469251; SV 1; linear; mRNA; EST; PLN; 524 BP.
JZ469251;
CCPd_EST_1050 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469252; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469252;
CCPd_EST_1051 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469253; SV 1; linear; mRNA; EST; PLN; 480 BP.
JZ469253;
CCPd_EST_1052 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469254; SV 1; linear; mRNA; EST; PLN; 490 BP.
JZ469254;
CCPd_EST_1053 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469255; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469255;
CCPd_EST_1054 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469256; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469256;
CCPd_EST_1055 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469257; SV 1; linear; mRNA; EST; PLN; 700 BP.
JZ469257;
CCPd_EST_1056 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469258; SV 1; linear; mRNA; EST; PLN; 550 BP.
JZ469258;
CCPd_EST_1057 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469259; SV 1; linear; mRNA; EST; PLN; 711 BP.
JZ469259;
CCPd_EST_1058 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469260; SV 1; linear; mRNA; EST; PLN; 700 BP.
JZ469260;
CCPd_EST_1059 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469261; SV 1; linear; mRNA; EST; PLN; 156 BP.
JZ469261;
CCPd_EST_106 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469262; SV 1; linear; mRNA; EST; PLN; 608 BP.
JZ469262;
CCPd_EST_1060 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469263; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469263;
CCPd_EST_1061 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469264; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ469264;
CCPd_EST_1063 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469265; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469265;
CCPd_EST_1065 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469266; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ469266;
CCPd_EST_1066 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469267; SV 1; linear; mRNA; EST; PLN; 439 BP.
JZ469267;
CCPd_EST_1067 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469268; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469268;
CCPd_EST_1069 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469269; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469269;
CCPd_EST_107 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469270; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469270;
CCPd_EST_1070 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469271; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469271;
CCPd_EST_1071 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469272; SV 1; linear; mRNA; EST; PLN; 496 BP.
JZ469272;
CCPd_EST_1072 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469273; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469273;
CCPd_EST_1073 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469274; SV 1; linear; mRNA; EST; PLN; 657 BP.
JZ469274;
CCPd_EST_1074 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469275; SV 1; linear; mRNA; EST; PLN; 583 BP.
JZ469275;
CCPd_EST_1075 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469276; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469276;
CCPd_EST_1076 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469277; SV 1; linear; mRNA; EST; PLN; 799 BP.
JZ469277;
CCPd_EST_1077 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469278; SV 1; linear; mRNA; EST; PLN; 612 BP.
JZ469278;
CCPd_EST_1078 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469279; SV 1; linear; mRNA; EST; PLN; 248 BP.
JZ469279;
CCPd_EST_1079 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469280; SV 1; linear; mRNA; EST; PLN; 549 BP.
JZ469280;
CCPd_EST_1081 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469281; SV 1; linear; mRNA; EST; PLN; 711 BP.
JZ469281;
CCPd_EST_1082 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469282; SV 1; linear; mRNA; EST; PLN; 592 BP.
JZ469282;
CCPd_EST_1083 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469283; SV 1; linear; mRNA; EST; PLN; 470 BP.
JZ469283;
CCPd_EST_1084 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469284; SV 1; linear; mRNA; EST; PLN; 126 BP.
JZ469284;
CCPd_EST_1085 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469285; SV 1; linear; mRNA; EST; PLN; 704 BP.
JZ469285;
CCPd_EST_1086 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469286; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469286;
CCPd_EST_1087 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469287; SV 1; linear; mRNA; EST; PLN; 650 BP.
JZ469287;
CCPd_EST_1088 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469288; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469288;
CCPd_EST_1089 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469289; SV 1; linear; mRNA; EST; PLN; 624 BP.
JZ469289;
CCPd_EST_1090 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469290; SV 1; linear; mRNA; EST; PLN; 560 BP.
JZ469290;
CCPd_EST_1091 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469291; SV 1; linear; mRNA; EST; PLN; 639 BP.
JZ469291;
CCPd_EST_1092 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469292; SV 1; linear; mRNA; EST; PLN; 787 BP.
JZ469292;
CCPd_EST_1093 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469293; SV 1; linear; mRNA; EST; PLN; 185 BP.
JZ469293;
CCPd_EST_1094 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469294; SV 1; linear; mRNA; EST; PLN; 741 BP.
JZ469294;
CCPd_EST_1095 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469295; SV 1; linear; mRNA; EST; PLN; 476 BP.
JZ469295;
CCPd_EST_1096 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469296; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469296;
CCPd_EST_1097 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469297; SV 1; linear; mRNA; EST; PLN; 487 BP.
JZ469297;
CCPd_EST_1098 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469298; SV 1; linear; mRNA; EST; PLN; 364 BP.
JZ469298;
CCPd_EST_11 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469299; SV 1; linear; mRNA; EST; PLN; 453 BP.
JZ469299;
CCPd_EST_110 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469300; SV 1; linear; mRNA; EST; PLN; 739 BP.
JZ469300;
CCPd_EST_1100 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469301; SV 1; linear; mRNA; EST; PLN; 230 BP.
JZ469301;
CCPd_EST_111 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469302; SV 1; linear; mRNA; EST; PLN; 438 BP.
JZ469302;
CCPd_EST_112 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469303; SV 1; linear; mRNA; EST; PLN; 590 BP.
JZ469303;
CCPd_EST_113 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469304; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469304;
CCPd_EST_114 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469305; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469305;
CCPd_EST_115 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469306; SV 1; linear; mRNA; EST; PLN; 192 BP.
JZ469306;
CCPd_EST_116 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469307; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469307;
CCPd_EST_118 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469308; SV 1; linear; mRNA; EST; PLN; 219 BP.
JZ469308;
CCPd_EST_119 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469309; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469309;
CCPd_EST_12 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469310; SV 1; linear; mRNA; EST; PLN; 671 BP.
JZ469310;
CCPd_EST_121 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469311; SV 1; linear; mRNA; EST; PLN; 196 BP.
JZ469311;
CCPd_EST_123 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469312; SV 1; linear; mRNA; EST; PLN; 554 BP.
JZ469312;
CCPd_EST_124 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469313; SV 1; linear; mRNA; EST; PLN; 248 BP.
JZ469313;
CCPd_EST_125 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469314; SV 1; linear; mRNA; EST; PLN; 142 BP.
JZ469314;
CCPd_EST_126 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469315; SV 1; linear; mRNA; EST; PLN; 334 BP.
JZ469315;
CCPd_EST_127 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469316; SV 1; linear; mRNA; EST; PLN; 480 BP.
JZ469316;
CCPd_EST_128 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469317; SV 1; linear; mRNA; EST; PLN; 152 BP.
JZ469317;
CCPd_EST_129 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469318; SV 1; linear; mRNA; EST; PLN; 330 BP.
JZ469318;
CCPd_EST_130 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469319; SV 1; linear; mRNA; EST; PLN; 503 BP.
JZ469319;
CCPd_EST_131 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469320; SV 1; linear; mRNA; EST; PLN; 192 BP.
JZ469320;
CCPd_EST_133 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469321; SV 1; linear; mRNA; EST; PLN; 323 BP.
JZ469321;
CCPd_EST_134 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469322; SV 1; linear; mRNA; EST; PLN; 413 BP.
JZ469322;
CCPd_EST_135 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469323; SV 1; linear; mRNA; EST; PLN; 351 BP.
JZ469323;
CCPd_EST_136 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469324; SV 1; linear; mRNA; EST; PLN; 201 BP.
JZ469324;
CCPd_EST_137 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469325; SV 1; linear; mRNA; EST; PLN; 129 BP.
JZ469325;
CCPd_EST_14 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469326; SV 1; linear; mRNA; EST; PLN; 520 BP.
JZ469326;
CCPd_EST_141 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469327; SV 1; linear; mRNA; EST; PLN; 395 BP.
JZ469327;
CCPd_EST_142 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469328; SV 1; linear; mRNA; EST; PLN; 504 BP.
JZ469328;
CCPd_EST_143 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469329; SV 1; linear; mRNA; EST; PLN; 209 BP.
JZ469329;
CCPd_EST_145 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469330; SV 1; linear; mRNA; EST; PLN; 232 BP.
JZ469330;
CCPd_EST_147 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469331; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469331;
CCPd_EST_149 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469332; SV 1; linear; mRNA; EST; PLN; 357 BP.
JZ469332;
CCPd_EST_150 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469333; SV 1; linear; mRNA; EST; PLN; 524 BP.
JZ469333;
CCPd_EST_151 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469334; SV 1; linear; mRNA; EST; PLN; 140 BP.
JZ469334;
CCPd_EST_153 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469335; SV 1; linear; mRNA; EST; PLN; 338 BP.
JZ469335;
CCPd_EST_154 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469336; SV 1; linear; mRNA; EST; PLN; 379 BP.
JZ469336;
CCPd_EST_155 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469337; SV 1; linear; mRNA; EST; PLN; 272 BP.
JZ469337;
CCPd_EST_156 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469338; SV 1; linear; mRNA; EST; PLN; 306 BP.
JZ469338;
CCPd_EST_157 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469339; SV 1; linear; mRNA; EST; PLN; 355 BP.
JZ469339;
CCPd_EST_158 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469340; SV 1; linear; mRNA; EST; PLN; 442 BP.
JZ469340;
CCPd_EST_159 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469341; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469341;
CCPd_EST_16 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469342; SV 1; linear; mRNA; EST; PLN; 245 BP.
JZ469342;
CCPd_EST_160 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469343; SV 1; linear; mRNA; EST; PLN; 416 BP.
JZ469343;
CCPd_EST_161 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469344; SV 1; linear; mRNA; EST; PLN; 355 BP.
JZ469344;
CCPd_EST_162 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469345; SV 1; linear; mRNA; EST; PLN; 280 BP.
JZ469345;
CCPd_EST_163 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469346; SV 1; linear; mRNA; EST; PLN; 395 BP.
JZ469346;
CCPd_EST_164 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469347; SV 1; linear; mRNA; EST; PLN; 573 BP.
JZ469347;
CCPd_EST_165 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469348; SV 1; linear; mRNA; EST; PLN; 621 BP.
JZ469348;
CCPd_EST_166 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469349; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469349;
CCPd_EST_167 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469350; SV 1; linear; mRNA; EST; PLN; 575 BP.
JZ469350;
CCPd_EST_168 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469351; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469351;
CCPd_EST_169 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469352; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469352;
CCPd_EST_171 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469353; SV 1; linear; mRNA; EST; PLN; 496 BP.
JZ469353;
CCPd_EST_172 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469354; SV 1; linear; mRNA; EST; PLN; 373 BP.
JZ469354;
CCPd_EST_173 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469355; SV 1; linear; mRNA; EST; PLN; 319 BP.
JZ469355;
CCPd_EST_174 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469356; SV 1; linear; mRNA; EST; PLN; 650 BP.
JZ469356;
CCPd_EST_175 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469357; SV 1; linear; mRNA; EST; PLN; 479 BP.
JZ469357;
CCPd_EST_177 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469358; SV 1; linear; mRNA; EST; PLN; 325 BP.
JZ469358;
CCPd_EST_178 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469359; SV 1; linear; mRNA; EST; PLN; 248 BP.
JZ469359;
CCPd_EST_179 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469360; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469360;
CCPd_EST_18 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469361; SV 1; linear; mRNA; EST; PLN; 693 BP.
JZ469361;
CCPd_EST_183 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469362; SV 1; linear; mRNA; EST; PLN; 441 BP.
JZ469362;
CCPd_EST_184 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469363; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ469363;
CCPd_EST_185 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469364; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469364;
CCPd_EST_186 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469365; SV 1; linear; mRNA; EST; PLN; 338 BP.
JZ469365;
CCPd_EST_187 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469366; SV 1; linear; mRNA; EST; PLN; 425 BP.
JZ469366;
CCPd_EST_189 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469367; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469367;
CCPd_EST_19 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469368; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469368;
CCPd_EST_190 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469369; SV 1; linear; mRNA; EST; PLN; 280 BP.
JZ469369;
CCPd_EST_191 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469370; SV 1; linear; mRNA; EST; PLN; 409 BP.
JZ469370;
CCPd_EST_192 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469371; SV 1; linear; mRNA; EST; PLN; 384 BP.
JZ469371;
CCPd_EST_193 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469372; SV 1; linear; mRNA; EST; PLN; 147 BP.
JZ469372;
CCPd_EST_194 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469373; SV 1; linear; mRNA; EST; PLN; 196 BP.
JZ469373;
CCPd_EST_195 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469374; SV 1; linear; mRNA; EST; PLN; 569 BP.
JZ469374;
CCPd_EST_196 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469375; SV 1; linear; mRNA; EST; PLN; 557 BP.
JZ469375;
CCPd_EST_197 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469376; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469376;
CCPd_EST_198 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469377; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469377;
CCPd_EST_2 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469378; SV 1; linear; mRNA; EST; PLN; 253 BP.
JZ469378;
CCPd_EST_20 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469379; SV 1; linear; mRNA; EST; PLN; 900 BP.
JZ469379;
CCPd_EST_200 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469380; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ469380;
CCPd_EST_201 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469381; SV 1; linear; mRNA; EST; PLN; 462 BP.
JZ469381;
CCPd_EST_202 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469382; SV 1; linear; mRNA; EST; PLN; 180 BP.
JZ469382;
CCPd_EST_203 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469383; SV 1; linear; mRNA; EST; PLN; 273 BP.
JZ469383;
CCPd_EST_204 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469384; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469384;
CCPd_EST_205 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469385; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469385;
CCPd_EST_206 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469386; SV 1; linear; mRNA; EST; PLN; 360 BP.
JZ469386;
CCPd_EST_207 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469387; SV 1; linear; mRNA; EST; PLN; 550 BP.
JZ469387;
CCPd_EST_208 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469388; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469388;
CCPd_EST_209 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469389; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469389;
CCPd_EST_21 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469390; SV 1; linear; mRNA; EST; PLN; 150 BP.
JZ469390;
CCPd_EST_210 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469391; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469391;
CCPd_EST_211 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469392; SV 1; linear; mRNA; EST; PLN; 365 BP.
JZ469392;
CCPd_EST_213 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469393; SV 1; linear; mRNA; EST; PLN; 132 BP.
JZ469393;
CCPd_EST_214 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469394; SV 1; linear; mRNA; EST; PLN; 334 BP.
JZ469394;
CCPd_EST_215 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469395; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469395;
CCPd_EST_216 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469396; SV 1; linear; mRNA; EST; PLN; 800 BP.
JZ469396;
CCPd_EST_217 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469397; SV 1; linear; mRNA; EST; PLN; 281 BP.
JZ469397;
CCPd_EST_218 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469398; SV 1; linear; mRNA; EST; PLN; 288 BP.
JZ469398;
CCPd_EST_219 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469399; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469399;
CCPd_EST_22 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469400; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469400;
CCPd_EST_220 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469401; SV 1; linear; mRNA; EST; PLN; 301 BP.
JZ469401;
CCPd_EST_221 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469402; SV 1; linear; mRNA; EST; PLN; 396 BP.
JZ469402;
CCPd_EST_222 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469403; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469403;
CCPd_EST_223 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469404; SV 1; linear; mRNA; EST; PLN; 226 BP.
JZ469404;
CCPd_EST_224 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469405; SV 1; linear; mRNA; EST; PLN; 539 BP.
JZ469405;
CCPd_EST_225 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469406; SV 1; linear; mRNA; EST; PLN; 412 BP.
JZ469406;
CCPd_EST_226 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469407; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469407;
CCPd_EST_227 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469408; SV 1; linear; mRNA; EST; PLN; 320 BP.
JZ469408;
CCPd_EST_228 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469409; SV 1; linear; mRNA; EST; PLN; 251 BP.
JZ469409;
CCPd_EST_229 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469410; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469410;
CCPd_EST_23 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469411; SV 1; linear; mRNA; EST; PLN; 356 BP.
JZ469411;
CCPd_EST_230 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469412; SV 1; linear; mRNA; EST; PLN; 486 BP.
JZ469412;
CCPd_EST_231 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469413; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469413;
CCPd_EST_232 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469414; SV 1; linear; mRNA; EST; PLN; 328 BP.
JZ469414;
CCPd_EST_233 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469415; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469415;
CCPd_EST_234 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469416; SV 1; linear; mRNA; EST; PLN; 663 BP.
JZ469416;
CCPd_EST_235 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469417; SV 1; linear; mRNA; EST; PLN; 417 BP.
JZ469417;
CCPd_EST_236 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469418; SV 1; linear; mRNA; EST; PLN; 165 BP.
JZ469418;
CCPd_EST_237 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469419; SV 1; linear; mRNA; EST; PLN; 550 BP.
JZ469419;
CCPd_EST_238 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469420; SV 1; linear; mRNA; EST; PLN; 645 BP.
JZ469420;
CCPd_EST_239 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469421; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469421;
CCPd_EST_24 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469422; SV 1; linear; mRNA; EST; PLN; 603 BP.
JZ469422;
CCPd_EST_240 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469423; SV 1; linear; mRNA; EST; PLN; 579 BP.
JZ469423;
CCPd_EST_241 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469424; SV 1; linear; mRNA; EST; PLN; 132 BP.
JZ469424;
CCPd_EST_242 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469425; SV 1; linear; mRNA; EST; PLN; 180 BP.
JZ469425;
CCPd_EST_243 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469426; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469426;
CCPd_EST_244 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469427; SV 1; linear; mRNA; EST; PLN; 150 BP.
JZ469427;
CCPd_EST_245 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469428; SV 1; linear; mRNA; EST; PLN; 550 BP.
JZ469428;
CCPd_EST_246 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469429; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469429;
CCPd_EST_247 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469430; SV 1; linear; mRNA; EST; PLN; 405 BP.
JZ469430;
CCPd_EST_248 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469431; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469431;
CCPd_EST_249 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469432; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469432;
CCPd_EST_25 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469433; SV 1; linear; mRNA; EST; PLN; 280 BP.
JZ469433;
CCPd_EST_250 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469434; SV 1; linear; mRNA; EST; PLN; 361 BP.
JZ469434;
CCPd_EST_251 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469435; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469435;
CCPd_EST_253 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469436; SV 1; linear; mRNA; EST; PLN; 304 BP.
JZ469436;
CCPd_EST_254 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469437; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469437;
CCPd_EST_256 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469438; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469438;
CCPd_EST_257 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469439; SV 1; linear; mRNA; EST; PLN; 224 BP.
JZ469439;
CCPd_EST_258 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469440; SV 1; linear; mRNA; EST; PLN; 309 BP.
JZ469440;
CCPd_EST_26 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469441; SV 1; linear; mRNA; EST; PLN; 488 BP.
JZ469441;
CCPd_EST_260 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469442; SV 1; linear; mRNA; EST; PLN; 220 BP.
JZ469442;
CCPd_EST_263 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469443; SV 1; linear; mRNA; EST; PLN; 361 BP.
JZ469443;
CCPd_EST_264 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469444; SV 1; linear; mRNA; EST; PLN; 707 BP.
JZ469444;
CCPd_EST_265 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469445; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469445;
CCPd_EST_266 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469446; SV 1; linear; mRNA; EST; PLN; 360 BP.
JZ469446;
CCPd_EST_267 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469447; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469447;
CCPd_EST_268 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469448; SV 1; linear; mRNA; EST; PLN; 497 BP.
JZ469448;
CCPd_EST_269 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469449; SV 1; linear; mRNA; EST; PLN; 391 BP.
JZ469449;
CCPd_EST_27 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469450; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469450;
CCPd_EST_270 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469451; SV 1; linear; mRNA; EST; PLN; 304 BP.
JZ469451;
CCPd_EST_273 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469452; SV 1; linear; mRNA; EST; PLN; 686 BP.
JZ469452;
CCPd_EST_274 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469453; SV 1; linear; mRNA; EST; PLN; 410 BP.
JZ469453;
CCPd_EST_275 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469454; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469454;
CCPd_EST_276 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469455; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469455;
CCPd_EST_277 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469456; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469456;
CCPd_EST_279 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469457; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469457;
CCPd_EST_28 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469458; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469458;
CCPd_EST_280 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469459; SV 1; linear; mRNA; EST; PLN; 255 BP.
JZ469459;
CCPd_EST_281 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469460; SV 1; linear; mRNA; EST; PLN; 346 BP.
JZ469460;
CCPd_EST_282 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469461; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469461;
CCPd_EST_283 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469462; SV 1; linear; mRNA; EST; PLN; 157 BP.
JZ469462;
CCPd_EST_284 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469463; SV 1; linear; mRNA; EST; PLN; 510 BP.
JZ469463;
CCPd_EST_286 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469464; SV 1; linear; mRNA; EST; PLN; 223 BP.
JZ469464;
CCPd_EST_288 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469465; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469465;
CCPd_EST_289 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469466; SV 1; linear; mRNA; EST; PLN; 426 BP.
JZ469466;
CCPd_EST_29 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469467; SV 1; linear; mRNA; EST; PLN; 306 BP.
JZ469467;
CCPd_EST_290 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469468; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469468;
CCPd_EST_291 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469469; SV 1; linear; mRNA; EST; PLN; 282 BP.
JZ469469;
CCPd_EST_292 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469470; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469470;
CCPd_EST_293 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469471; SV 1; linear; mRNA; EST; PLN; 276 BP.
JZ469471;
CCPd_EST_294 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469472; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469472;
CCPd_EST_296 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469473; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469473;
CCPd_EST_297 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469474; SV 1; linear; mRNA; EST; PLN; 337 BP.
JZ469474;
CCPd_EST_299 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469475; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469475;
CCPd_EST_3 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469476; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469476;
CCPd_EST_30 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469477; SV 1; linear; mRNA; EST; PLN; 223 BP.
JZ469477;
CCPd_EST_300 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469478; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469478;
CCPd_EST_301 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469479; SV 1; linear; mRNA; EST; PLN; 291 BP.
JZ469479;
CCPd_EST_302 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469480; SV 1; linear; mRNA; EST; PLN; 514 BP.
JZ469480;
CCPd_EST_303 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469481; SV 1; linear; mRNA; EST; PLN; 330 BP.
JZ469481;
CCPd_EST_304 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469482; SV 1; linear; mRNA; EST; PLN; 307 BP.
JZ469482;
CCPd_EST_305 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469483; SV 1; linear; mRNA; EST; PLN; 301 BP.
JZ469483;
CCPd_EST_306 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469484; SV 1; linear; mRNA; EST; PLN; 269 BP.
JZ469484;
CCPd_EST_307 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469485; SV 1; linear; mRNA; EST; PLN; 140 BP.
JZ469485;
CCPd_EST_308 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469486; SV 1; linear; mRNA; EST; PLN; 260 BP.
JZ469486;
CCPd_EST_309 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469487; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469487;
CCPd_EST_31 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469488; SV 1; linear; mRNA; EST; PLN; 150 BP.
JZ469488;
CCPd_EST_310 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469489; SV 1; linear; mRNA; EST; PLN; 357 BP.
JZ469489;
CCPd_EST_311 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469490; SV 1; linear; mRNA; EST; PLN; 370 BP.
JZ469490;
CCPd_EST_313 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469491; SV 1; linear; mRNA; EST; PLN; 304 BP.
JZ469491;
CCPd_EST_314 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469492; SV 1; linear; mRNA; EST; PLN; 306 BP.
JZ469492;
CCPd_EST_315 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469493; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469493;
CCPd_EST_316 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469494; SV 1; linear; mRNA; EST; PLN; 333 BP.
JZ469494;
CCPd_EST_317 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469495; SV 1; linear; mRNA; EST; PLN; 238 BP.
JZ469495;
CCPd_EST_318 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469496; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469496;
CCPd_EST_319 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469497; SV 1; linear; mRNA; EST; PLN; 180 BP.
JZ469497;
CCPd_EST_32 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469498; SV 1; linear; mRNA; EST; PLN; 201 BP.
JZ469498;
CCPd_EST_320 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469499; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469499;
CCPd_EST_321 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469500; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469500;
CCPd_EST_322 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469501; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469501;
CCPd_EST_323 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469502; SV 1; linear; mRNA; EST; PLN; 170 BP.
JZ469502;
CCPd_EST_324 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469503; SV 1; linear; mRNA; EST; PLN; 558 BP.
JZ469503;
CCPd_EST_325 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469504; SV 1; linear; mRNA; EST; PLN; 560 BP.
JZ469504;
CCPd_EST_327 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469505; SV 1; linear; mRNA; EST; PLN; 305 BP.
JZ469505;
CCPd_EST_329 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469506; SV 1; linear; mRNA; EST; PLN; 416 BP.
JZ469506;
CCPd_EST_33 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469507; SV 1; linear; mRNA; EST; PLN; 202 BP.
JZ469507;
CCPd_EST_330 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469508; SV 1; linear; mRNA; EST; PLN; 582 BP.
JZ469508;
CCPd_EST_332 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469509; SV 1; linear; mRNA; EST; PLN; 233 BP.
JZ469509;
CCPd_EST_333 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469510; SV 1; linear; mRNA; EST; PLN; 222 BP.
JZ469510;
CCPd_EST_334 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469511; SV 1; linear; mRNA; EST; PLN; 181 BP.
JZ469511;
CCPd_EST_335 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469512; SV 1; linear; mRNA; EST; PLN; 143 BP.
JZ469512;
CCPd_EST_336 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469513; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469513;
CCPd_EST_337 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469514; SV 1; linear; mRNA; EST; PLN; 137 BP.
JZ469514;
CCPd_EST_338 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469515; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469515;
CCPd_EST_34 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469516; SV 1; linear; mRNA; EST; PLN; 183 BP.
JZ469516;
CCPd_EST_340 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469517; SV 1; linear; mRNA; EST; PLN; 431 BP.
JZ469517;
CCPd_EST_342 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469518; SV 1; linear; mRNA; EST; PLN; 953 BP.
JZ469518;
CCPd_EST_343 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469519; SV 1; linear; mRNA; EST; PLN; 506 BP.
JZ469519;
CCPd_EST_344 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469520; SV 1; linear; mRNA; EST; PLN; 750 BP.
JZ469520;
CCPd_EST_345 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469521; SV 1; linear; mRNA; EST; PLN; 618 BP.
JZ469521;
CCPd_EST_346 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469522; SV 1; linear; mRNA; EST; PLN; 280 BP.
JZ469522;
CCPd_EST_347 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469523; SV 1; linear; mRNA; EST; PLN; 222 BP.
JZ469523;
CCPd_EST_348 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469524; SV 1; linear; mRNA; EST; PLN; 155 BP.
JZ469524;
CCPd_EST_349 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469525; SV 1; linear; mRNA; EST; PLN; 488 BP.
JZ469525;
CCPd_EST_35 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469526; SV 1; linear; mRNA; EST; PLN; 478 BP.
JZ469526;
CCPd_EST_351 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469527; SV 1; linear; mRNA; EST; PLN; 323 BP.
JZ469527;
CCPd_EST_352 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469528; SV 1; linear; mRNA; EST; PLN; 259 BP.
JZ469528;
CCPd_EST_353 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469529; SV 1; linear; mRNA; EST; PLN; 432 BP.
JZ469529;
CCPd_EST_354 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469530; SV 1; linear; mRNA; EST; PLN; 365 BP.
JZ469530;
CCPd_EST_355 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469531; SV 1; linear; mRNA; EST; PLN; 382 BP.
JZ469531;
CCPd_EST_356 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469532; SV 1; linear; mRNA; EST; PLN; 150 BP.
JZ469532;
CCPd_EST_357 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469533; SV 1; linear; mRNA; EST; PLN; 288 BP.
JZ469533;
CCPd_EST_358 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469534; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469534;
CCPd_EST_359 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469535; SV 1; linear; mRNA; EST; PLN; 176 BP.
JZ469535;
CCPd_EST_36 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469536; SV 1; linear; mRNA; EST; PLN; 342 BP.
JZ469536;
CCPd_EST_360 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469537; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ469537;
CCPd_EST_361 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469538; SV 1; linear; mRNA; EST; PLN; 550 BP.
JZ469538;
CCPd_EST_362 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469539; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469539;
CCPd_EST_363 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469540; SV 1; linear; mRNA; EST; PLN; 150 BP.
JZ469540;
CCPd_EST_364 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469541; SV 1; linear; mRNA; EST; PLN; 317 BP.
JZ469541;
CCPd_EST_366 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469542; SV 1; linear; mRNA; EST; PLN; 170 BP.
JZ469542;
CCPd_EST_367 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469543; SV 1; linear; mRNA; EST; PLN; 222 BP.
JZ469543;
CCPd_EST_368 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469544; SV 1; linear; mRNA; EST; PLN; 181 BP.
JZ469544;
CCPd_EST_369 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469545; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469545;
CCPd_EST_37 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469546; SV 1; linear; mRNA; EST; PLN; 296 BP.
JZ469546;
CCPd_EST_370 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469547; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469547;
CCPd_EST_371 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469548; SV 1; linear; mRNA; EST; PLN; 351 BP.
JZ469548;
CCPd_EST_372 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469549; SV 1; linear; mRNA; EST; PLN; 372 BP.
JZ469549;
CCPd_EST_373 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469550; SV 1; linear; mRNA; EST; PLN; 224 BP.
JZ469550;
CCPd_EST_374 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469551; SV 1; linear; mRNA; EST; PLN; 308 BP.
JZ469551;
CCPd_EST_375 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469552; SV 1; linear; mRNA; EST; PLN; 222 BP.
JZ469552;
CCPd_EST_376 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469553; SV 1; linear; mRNA; EST; PLN; 280 BP.
JZ469553;
CCPd_EST_377 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469554; SV 1; linear; mRNA; EST; PLN; 222 BP.
JZ469554;
CCPd_EST_378 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469555; SV 1; linear; mRNA; EST; PLN; 567 BP.
JZ469555;
CCPd_EST_379 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469556; SV 1; linear; mRNA; EST; PLN; 376 BP.
JZ469556;
CCPd_EST_38 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469557; SV 1; linear; mRNA; EST; PLN; 800 BP.
JZ469557;
CCPd_EST_380 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469558; SV 1; linear; mRNA; EST; PLN; 226 BP.
JZ469558;
CCPd_EST_381 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469559; SV 1; linear; mRNA; EST; PLN; 688 BP.
JZ469559;
CCPd_EST_382 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469560; SV 1; linear; mRNA; EST; PLN; 590 BP.
JZ469560;
CCPd_EST_383 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469561; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469561;
CCPd_EST_384 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469562; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469562;
CCPd_EST_385 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469563; SV 1; linear; mRNA; EST; PLN; 190 BP.
JZ469563;
CCPd_EST_386 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469564; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469564;
CCPd_EST_387 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469565; SV 1; linear; mRNA; EST; PLN; 209 BP.
JZ469565;
CCPd_EST_388 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469566; SV 1; linear; mRNA; EST; PLN; 485 BP.
JZ469566;
CCPd_EST_389 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469567; SV 1; linear; mRNA; EST; PLN; 239 BP.
JZ469567;
CCPd_EST_39 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469568; SV 1; linear; mRNA; EST; PLN; 394 BP.
JZ469568;
CCPd_EST_390 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469569; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469569;
CCPd_EST_391 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469570; SV 1; linear; mRNA; EST; PLN; 468 BP.
JZ469570;
CCPd_EST_393 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469571; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469571;
CCPd_EST_394 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469572; SV 1; linear; mRNA; EST; PLN; 474 BP.
JZ469572;
CCPd_EST_395 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469573; SV 1; linear; mRNA; EST; PLN; 391 BP.
JZ469573;
CCPd_EST_398 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469574; SV 1; linear; mRNA; EST; PLN; 570 BP.
JZ469574;
CCPd_EST_399 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469575; SV 1; linear; mRNA; EST; PLN; 425 BP.
JZ469575;
CCPd_EST_4 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469576; SV 1; linear; mRNA; EST; PLN; 462 BP.
JZ469576;
CCPd_EST_40 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469577; SV 1; linear; mRNA; EST; PLN; 320 BP.
JZ469577;
CCPd_EST_401 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469578; SV 1; linear; mRNA; EST; PLN; 267 BP.
JZ469578;
CCPd_EST_402 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469579; SV 1; linear; mRNA; EST; PLN; 181 BP.
JZ469579;
CCPd_EST_403 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469580; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469580;
CCPd_EST_404 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469581; SV 1; linear; mRNA; EST; PLN; 323 BP.
JZ469581;
CCPd_EST_405 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469582; SV 1; linear; mRNA; EST; PLN; 243 BP.
JZ469582;
CCPd_EST_406 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469583; SV 1; linear; mRNA; EST; PLN; 386 BP.
JZ469583;
CCPd_EST_408 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469584; SV 1; linear; mRNA; EST; PLN; 662 BP.
JZ469584;
CCPd_EST_409 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469585; SV 1; linear; mRNA; EST; PLN; 189 BP.
JZ469585;
CCPd_EST_41 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469586; SV 1; linear; mRNA; EST; PLN; 284 BP.
JZ469586;
CCPd_EST_410 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469587; SV 1; linear; mRNA; EST; PLN; 335 BP.
JZ469587;
CCPd_EST_411 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469588; SV 1; linear; mRNA; EST; PLN; 748 BP.
JZ469588;
CCPd_EST_412 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469589; SV 1; linear; mRNA; EST; PLN; 388 BP.
JZ469589;
CCPd_EST_413 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469590; SV 1; linear; mRNA; EST; PLN; 190 BP.
JZ469590;
CCPd_EST_415 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469591; SV 1; linear; mRNA; EST; PLN; 290 BP.
JZ469591;
CCPd_EST_416 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469592; SV 1; linear; mRNA; EST; PLN; 177 BP.
JZ469592;
CCPd_EST_418 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469593; SV 1; linear; mRNA; EST; PLN; 317 BP.
JZ469593;
CCPd_EST_419 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469594; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469594;
CCPd_EST_42 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469595; SV 1; linear; mRNA; EST; PLN; 66 BP.
JZ469595;
CCPd_EST_422 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469596; SV 1; linear; mRNA; EST; PLN; 601 BP.
JZ469596;
CCPd_EST_423 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469597; SV 1; linear; mRNA; EST; PLN; 118 BP.
JZ469597;
CCPd_EST_424 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469598; SV 1; linear; mRNA; EST; PLN; 523 BP.
JZ469598;
CCPd_EST_425 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469599; SV 1; linear; mRNA; EST; PLN; 142 BP.
JZ469599;
CCPd_EST_426 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469600; SV 1; linear; mRNA; EST; PLN; 378 BP.
JZ469600;
CCPd_EST_427 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469601; SV 1; linear; mRNA; EST; PLN; 362 BP.
JZ469601;
CCPd_EST_428 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469602; SV 1; linear; mRNA; EST; PLN; 180 BP.
JZ469602;
CCPd_EST_429 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469603; SV 1; linear; mRNA; EST; PLN; 303 BP.
JZ469603;
CCPd_EST_43 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469604; SV 1; linear; mRNA; EST; PLN; 357 BP.
JZ469604;
CCPd_EST_430 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469605; SV 1; linear; mRNA; EST; PLN; 506 BP.
JZ469605;
CCPd_EST_431 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469606; SV 1; linear; mRNA; EST; PLN; 302 BP.
JZ469606;
CCPd_EST_432 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469607; SV 1; linear; mRNA; EST; PLN; 195 BP.
JZ469607;
CCPd_EST_433 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469608; SV 1; linear; mRNA; EST; PLN; 515 BP.
JZ469608;
CCPd_EST_434 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469609; SV 1; linear; mRNA; EST; PLN; 340 BP.
JZ469609;
CCPd_EST_435 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469610; SV 1; linear; mRNA; EST; PLN; 249 BP.
JZ469610;
CCPd_EST_436 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469611; SV 1; linear; mRNA; EST; PLN; 239 BP.
JZ469611;
CCPd_EST_437 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469612; SV 1; linear; mRNA; EST; PLN; 378 BP.
JZ469612;
CCPd_EST_438 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469613; SV 1; linear; mRNA; EST; PLN; 182 BP.
JZ469613;
CCPd_EST_439 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469614; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469614;
CCPd_EST_44 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469615; SV 1; linear; mRNA; EST; PLN; 485 BP.
JZ469615;
CCPd_EST_440 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469616; SV 1; linear; mRNA; EST; PLN; 416 BP.
JZ469616;
CCPd_EST_441 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469617; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469617;
CCPd_EST_442 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469618; SV 1; linear; mRNA; EST; PLN; 426 BP.
JZ469618;
CCPd_EST_446 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469619; SV 1; linear; mRNA; EST; PLN; 133 BP.
JZ469619;
CCPd_EST_447 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469620; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469620;
CCPd_EST_448 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469621; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469621;
CCPd_EST_449 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469622; SV 1; linear; mRNA; EST; PLN; 615 BP.
JZ469622;
CCPd_EST_45 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469623; SV 1; linear; mRNA; EST; PLN; 271 BP.
JZ469623;
CCPd_EST_450 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469624; SV 1; linear; mRNA; EST; PLN; 531 BP.
JZ469624;
CCPd_EST_451 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469625; SV 1; linear; mRNA; EST; PLN; 131 BP.
JZ469625;
CCPd_EST_452 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469626; SV 1; linear; mRNA; EST; PLN; 570 BP.
JZ469626;
CCPd_EST_453 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469627; SV 1; linear; mRNA; EST; PLN; 159 BP.
JZ469627;
CCPd_EST_454 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469628; SV 1; linear; mRNA; EST; PLN; 221 BP.
JZ469628;
CCPd_EST_455 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469629; SV 1; linear; mRNA; EST; PLN; 245 BP.
JZ469629;
CCPd_EST_456 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469630; SV 1; linear; mRNA; EST; PLN; 339 BP.
JZ469630;
CCPd_EST_457 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469631; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469631;
CCPd_EST_458 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469632; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469632;
CCPd_EST_46 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469633; SV 1; linear; mRNA; EST; PLN; 168 BP.
JZ469633;
CCPd_EST_460 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469634; SV 1; linear; mRNA; EST; PLN; 462 BP.
JZ469634;
CCPd_EST_461 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469635; SV 1; linear; mRNA; EST; PLN; 212 BP.
JZ469635;
CCPd_EST_462 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469636; SV 1; linear; mRNA; EST; PLN; 139 BP.
JZ469636;
CCPd_EST_463 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469637; SV 1; linear; mRNA; EST; PLN; 285 BP.
JZ469637;
CCPd_EST_464 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469638; SV 1; linear; mRNA; EST; PLN; 296 BP.
JZ469638;
CCPd_EST_465 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469639; SV 1; linear; mRNA; EST; PLN; 182 BP.
JZ469639;
CCPd_EST_466 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469640; SV 1; linear; mRNA; EST; PLN; 518 BP.
JZ469640;
CCPd_EST_467 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469641; SV 1; linear; mRNA; EST; PLN; 413 BP.
JZ469641;
CCPd_EST_468 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469642; SV 1; linear; mRNA; EST; PLN; 510 BP.
JZ469642;
CCPd_EST_47 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469643; SV 1; linear; mRNA; EST; PLN; 321 BP.
JZ469643;
CCPd_EST_470 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469644; SV 1; linear; mRNA; EST; PLN; 603 BP.
JZ469644;
CCPd_EST_471 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469645; SV 1; linear; mRNA; EST; PLN; 251 BP.
JZ469645;
CCPd_EST_472 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469646; SV 1; linear; mRNA; EST; PLN; 174 BP.
JZ469646;
CCPd_EST_473 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469647; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ469647;
CCPd_EST_474 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469648; SV 1; linear; mRNA; EST; PLN; 488 BP.
JZ469648;
CCPd_EST_475 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469649; SV 1; linear; mRNA; EST; PLN; 310 BP.
JZ469649;
CCPd_EST_476 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469650; SV 1; linear; mRNA; EST; PLN; 334 BP.
JZ469650;
CCPd_EST_477 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469651; SV 1; linear; mRNA; EST; PLN; 448 BP.
JZ469651;
CCPd_EST_478 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469652; SV 1; linear; mRNA; EST; PLN; 220 BP.
JZ469652;
CCPd_EST_479 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469653; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469653;
CCPd_EST_48 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469654; SV 1; linear; mRNA; EST; PLN; 141 BP.
JZ469654;
CCPd_EST_481 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469655; SV 1; linear; mRNA; EST; PLN; 170 BP.
JZ469655;
CCPd_EST_482 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469656; SV 1; linear; mRNA; EST; PLN; 168 BP.
JZ469656;
CCPd_EST_483 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469657; SV 1; linear; mRNA; EST; PLN; 413 BP.
JZ469657;
CCPd_EST_484 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469658; SV 1; linear; mRNA; EST; PLN; 516 BP.
JZ469658;
CCPd_EST_485 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469659; SV 1; linear; mRNA; EST; PLN; 180 BP.
JZ469659;
CCPd_EST_486 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469660; SV 1; linear; mRNA; EST; PLN; 426 BP.
JZ469660;
CCPd_EST_487 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469661; SV 1; linear; mRNA; EST; PLN; 760 BP.
JZ469661;
CCPd_EST_488 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469662; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469662;
CCPd_EST_489 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469663; SV 1; linear; mRNA; EST; PLN; 408 BP.
JZ469663;
CCPd_EST_49 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469664; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469664;
CCPd_EST_490 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469665; SV 1; linear; mRNA; EST; PLN; 538 BP.
JZ469665;
CCPd_EST_493 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469666; SV 1; linear; mRNA; EST; PLN; 496 BP.
JZ469666;
CCPd_EST_494 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469667; SV 1; linear; mRNA; EST; PLN; 462 BP.
JZ469667;
CCPd_EST_495 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469668; SV 1; linear; mRNA; EST; PLN; 435 BP.
JZ469668;
CCPd_EST_497 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469669; SV 1; linear; mRNA; EST; PLN; 317 BP.
JZ469669;
CCPd_EST_498 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469670; SV 1; linear; mRNA; EST; PLN; 435 BP.
JZ469670;
CCPd_EST_499 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469671; SV 1; linear; mRNA; EST; PLN; 274 BP.
JZ469671;
CCPd_EST_5 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469672; SV 1; linear; mRNA; EST; PLN; 396 BP.
JZ469672;
CCPd_EST_50 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469673; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469673;
CCPd_EST_500 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469674; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469674;
CCPd_EST_501 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469675; SV 1; linear; mRNA; EST; PLN; 196 BP.
JZ469675;
CCPd_EST_502 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469676; SV 1; linear; mRNA; EST; PLN; 231 BP.
JZ469676;
CCPd_EST_505 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469677; SV 1; linear; mRNA; EST; PLN; 288 BP.
JZ469677;
CCPd_EST_506 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469678; SV 1; linear; mRNA; EST; PLN; 150 BP.
JZ469678;
CCPd_EST_507 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469679; SV 1; linear; mRNA; EST; PLN; 477 BP.
JZ469679;
CCPd_EST_51 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469680; SV 1; linear; mRNA; EST; PLN; 468 BP.
JZ469680;
CCPd_EST_510 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469681; SV 1; linear; mRNA; EST; PLN; 321 BP.
JZ469681;
CCPd_EST_511 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469682; SV 1; linear; mRNA; EST; PLN; 192 BP.
JZ469682;
CCPd_EST_512 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469683; SV 1; linear; mRNA; EST; PLN; 380 BP.
JZ469683;
CCPd_EST_513 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469684; SV 1; linear; mRNA; EST; PLN; 584 BP.
JZ469684;
CCPd_EST_514 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469685; SV 1; linear; mRNA; EST; PLN; 297 BP.
JZ469685;
CCPd_EST_515 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469686; SV 1; linear; mRNA; EST; PLN; 205 BP.
JZ469686;
CCPd_EST_517 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469687; SV 1; linear; mRNA; EST; PLN; 344 BP.
JZ469687;
CCPd_EST_518 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469688; SV 1; linear; mRNA; EST; PLN; 697 BP.
JZ469688;
CCPd_EST_52 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469689; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469689;
CCPd_EST_521 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469690; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ469690;
CCPd_EST_524 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469691; SV 1; linear; mRNA; EST; PLN; 463 BP.
JZ469691;
CCPd_EST_525 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469692; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469692;
CCPd_EST_526 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469693; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469693;
CCPd_EST_527 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469694; SV 1; linear; mRNA; EST; PLN; 362 BP.
JZ469694;
CCPd_EST_529 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469695; SV 1; linear; mRNA; EST; PLN; 180 BP.
JZ469695;
CCPd_EST_53 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469696; SV 1; linear; mRNA; EST; PLN; 222 BP.
JZ469696;
CCPd_EST_530 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469697; SV 1; linear; mRNA; EST; PLN; 309 BP.
JZ469697;
CCPd_EST_531 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469698; SV 1; linear; mRNA; EST; PLN; 290 BP.
JZ469698;
CCPd_EST_533 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469699; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469699;
CCPd_EST_534 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469700; SV 1; linear; mRNA; EST; PLN; 150 BP.
JZ469700;
CCPd_EST_535 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469701; SV 1; linear; mRNA; EST; PLN; 700 BP.
JZ469701;
CCPd_EST_537 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469702; SV 1; linear; mRNA; EST; PLN; 590 BP.
JZ469702;
CCPd_EST_538 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469703; SV 1; linear; mRNA; EST; PLN; 313 BP.
JZ469703;
CCPd_EST_539 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469704; SV 1; linear; mRNA; EST; PLN; 556 BP.
JZ469704;
CCPd_EST_54 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469705; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469705;
CCPd_EST_541 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469706; SV 1; linear; mRNA; EST; PLN; 286 BP.
JZ469706;
CCPd_EST_542 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469707; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469707;
CCPd_EST_543 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469708; SV 1; linear; mRNA; EST; PLN; 157 BP.
JZ469708;
CCPd_EST_544 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469709; SV 1; linear; mRNA; EST; PLN; 292 BP.
JZ469709;
CCPd_EST_546 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469710; SV 1; linear; mRNA; EST; PLN; 239 BP.
JZ469710;
CCPd_EST_548 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469711; SV 1; linear; mRNA; EST; PLN; 454 BP.
JZ469711;
CCPd_EST_549 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469712; SV 1; linear; mRNA; EST; PLN; 506 BP.
JZ469712;
CCPd_EST_55 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469713; SV 1; linear; mRNA; EST; PLN; 312 BP.
JZ469713;
CCPd_EST_551 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469714; SV 1; linear; mRNA; EST; PLN; 241 BP.
JZ469714;
CCPd_EST_552 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469715; SV 1; linear; mRNA; EST; PLN; 507 BP.
JZ469715;
CCPd_EST_555 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469716; SV 1; linear; mRNA; EST; PLN; 206 BP.
JZ469716;
CCPd_EST_556 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469717; SV 1; linear; mRNA; EST; PLN; 750 BP.
JZ469717;
CCPd_EST_557 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469718; SV 1; linear; mRNA; EST; PLN; 647 BP.
JZ469718;
CCPd_EST_558 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469719; SV 1; linear; mRNA; EST; PLN; 451 BP.
JZ469719;
CCPd_EST_559 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469720; SV 1; linear; mRNA; EST; PLN; 568 BP.
JZ469720;
CCPd_EST_56 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469721; SV 1; linear; mRNA; EST; PLN; 352 BP.
JZ469721;
CCPd_EST_560 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469722; SV 1; linear; mRNA; EST; PLN; 535 BP.
JZ469722;
CCPd_EST_562 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469723; SV 1; linear; mRNA; EST; PLN; 195 BP.
JZ469723;
CCPd_EST_563 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469724; SV 1; linear; mRNA; EST; PLN; 396 BP.
JZ469724;
CCPd_EST_564 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469725; SV 1; linear; mRNA; EST; PLN; 178 BP.
JZ469725;
CCPd_EST_565 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469726; SV 1; linear; mRNA; EST; PLN; 334 BP.
JZ469726;
CCPd_EST_566 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469727; SV 1; linear; mRNA; EST; PLN; 238 BP.
JZ469727;
CCPd_EST_567 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469728; SV 1; linear; mRNA; EST; PLN; 433 BP.
JZ469728;
CCPd_EST_568 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469729; SV 1; linear; mRNA; EST; PLN; 458 BP.
JZ469729;
CCPd_EST_569 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469730; SV 1; linear; mRNA; EST; PLN; 375 BP.
JZ469730;
CCPd_EST_57 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469731; SV 1; linear; mRNA; EST; PLN; 267 BP.
JZ469731;
CCPd_EST_570 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469732; SV 1; linear; mRNA; EST; PLN; 693 BP.
JZ469732;
CCPd_EST_571 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469733; SV 1; linear; mRNA; EST; PLN; 399 BP.
JZ469733;
CCPd_EST_572 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469734; SV 1; linear; mRNA; EST; PLN; 363 BP.
JZ469734;
CCPd_EST_574 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469735; SV 1; linear; mRNA; EST; PLN; 635 BP.
JZ469735;
CCPd_EST_576 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469736; SV 1; linear; mRNA; EST; PLN; 230 BP.
JZ469736;
CCPd_EST_578 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469737; SV 1; linear; mRNA; EST; PLN; 260 BP.
JZ469737;
CCPd_EST_579 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469738; SV 1; linear; mRNA; EST; PLN; 365 BP.
JZ469738;
CCPd_EST_580 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469739; SV 1; linear; mRNA; EST; PLN; 150 BP.
JZ469739;
CCPd_EST_581 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469740; SV 1; linear; mRNA; EST; PLN; 362 BP.
JZ469740;
CCPd_EST_582 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469741; SV 1; linear; mRNA; EST; PLN; 357 BP.
JZ469741;
CCPd_EST_583 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469742; SV 1; linear; mRNA; EST; PLN; 149 BP.
JZ469742;
CCPd_EST_584 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469743; SV 1; linear; mRNA; EST; PLN; 372 BP.
JZ469743;
CCPd_EST_586 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469744; SV 1; linear; mRNA; EST; PLN; 764 BP.
JZ469744;
CCPd_EST_589 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469745; SV 1; linear; mRNA; EST; PLN; 826 BP.
JZ469745;
CCPd_EST_590 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469746; SV 1; linear; mRNA; EST; PLN; 161 BP.
JZ469746;
CCPd_EST_592 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469747; SV 1; linear; mRNA; EST; PLN; 382 BP.
JZ469747;
CCPd_EST_593 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469748; SV 1; linear; mRNA; EST; PLN; 441 BP.
JZ469748;
CCPd_EST_594 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469749; SV 1; linear; mRNA; EST; PLN; 346 BP.
JZ469749;
CCPd_EST_595 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469750; SV 1; linear; mRNA; EST; PLN; 528 BP.
JZ469750;
CCPd_EST_596 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469751; SV 1; linear; mRNA; EST; PLN; 507 BP.
JZ469751;
CCPd_EST_597 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469752; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ469752;
CCPd_EST_599 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469753; SV 1; linear; mRNA; EST; PLN; 315 BP.
JZ469753;
CCPd_EST_6 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469754; SV 1; linear; mRNA; EST; PLN; 240 BP.
JZ469754;
CCPd_EST_60 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469755; SV 1; linear; mRNA; EST; PLN; 174 BP.
JZ469755;
CCPd_EST_600 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469756; SV 1; linear; mRNA; EST; PLN; 201 BP.
JZ469756;
CCPd_EST_601 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469757; SV 1; linear; mRNA; EST; PLN; 698 BP.
JZ469757;
CCPd_EST_602 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469758; SV 1; linear; mRNA; EST; PLN; 496 BP.
JZ469758;
CCPd_EST_603 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469759; SV 1; linear; mRNA; EST; PLN; 378 BP.
JZ469759;
CCPd_EST_604 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469760; SV 1; linear; mRNA; EST; PLN; 226 BP.
JZ469760;
CCPd_EST_606 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469761; SV 1; linear; mRNA; EST; PLN; 288 BP.
JZ469761;
CCPd_EST_608 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469762; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469762;
CCPd_EST_609 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469763; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469763;
CCPd_EST_61 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469764; SV 1; linear; mRNA; EST; PLN; 535 BP.
JZ469764;
CCPd_EST_610 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469765; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469765;
CCPd_EST_613 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469766; SV 1; linear; mRNA; EST; PLN; 495 BP.
JZ469766;
CCPd_EST_614 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469767; SV 1; linear; mRNA; EST; PLN; 242 BP.
JZ469767;
CCPd_EST_615 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469768; SV 1; linear; mRNA; EST; PLN; 429 BP.
JZ469768;
CCPd_EST_617 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469769; SV 1; linear; mRNA; EST; PLN; 341 BP.
JZ469769;
CCPd_EST_618 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469770; SV 1; linear; mRNA; EST; PLN; 555 BP.
JZ469770;
CCPd_EST_619 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469771; SV 1; linear; mRNA; EST; PLN; 541 BP.
JZ469771;
CCPd_EST_62 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469772; SV 1; linear; mRNA; EST; PLN; 456 BP.
JZ469772;
CCPd_EST_620 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469773; SV 1; linear; mRNA; EST; PLN; 563 BP.
JZ469773;
CCPd_EST_622 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469774; SV 1; linear; mRNA; EST; PLN; 282 BP.
JZ469774;
CCPd_EST_623 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469775; SV 1; linear; mRNA; EST; PLN; 582 BP.
JZ469775;
CCPd_EST_624 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469776; SV 1; linear; mRNA; EST; PLN; 310 BP.
JZ469776;
CCPd_EST_625 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469777; SV 1; linear; mRNA; EST; PLN; 438 BP.
JZ469777;
CCPd_EST_626 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469778; SV 1; linear; mRNA; EST; PLN; 492 BP.
JZ469778;
CCPd_EST_627 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469779; SV 1; linear; mRNA; EST; PLN; 417 BP.
JZ469779;
CCPd_EST_628 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469780; SV 1; linear; mRNA; EST; PLN; 528 BP.
JZ469780;
CCPd_EST_629 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469781; SV 1; linear; mRNA; EST; PLN; 558 BP.
JZ469781;
CCPd_EST_63 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469782; SV 1; linear; mRNA; EST; PLN; 497 BP.
JZ469782;
CCPd_EST_630 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469783; SV 1; linear; mRNA; EST; PLN; 488 BP.
JZ469783;
CCPd_EST_631 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469784; SV 1; linear; mRNA; EST; PLN; 230 BP.
JZ469784;
CCPd_EST_632 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469785; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469785;
CCPd_EST_633 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469786; SV 1; linear; mRNA; EST; PLN; 257 BP.
JZ469786;
CCPd_EST_635 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469787; SV 1; linear; mRNA; EST; PLN; 483 BP.
JZ469787;
CCPd_EST_636 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469788; SV 1; linear; mRNA; EST; PLN; 434 BP.
JZ469788;
CCPd_EST_637 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469789; SV 1; linear; mRNA; EST; PLN; 754 BP.
JZ469789;
CCPd_EST_638 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469790; SV 1; linear; mRNA; EST; PLN; 252 BP.
JZ469790;
CCPd_EST_639 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469791; SV 1; linear; mRNA; EST; PLN; 176 BP.
JZ469791;
CCPd_EST_640 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469792; SV 1; linear; mRNA; EST; PLN; 320 BP.
JZ469792;
CCPd_EST_641 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469793; SV 1; linear; mRNA; EST; PLN; 363 BP.
JZ469793;
CCPd_EST_642 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469794; SV 1; linear; mRNA; EST; PLN; 370 BP.
JZ469794;
CCPd_EST_644 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469795; SV 1; linear; mRNA; EST; PLN; 247 BP.
JZ469795;
CCPd_EST_645 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469796; SV 1; linear; mRNA; EST; PLN; 162 BP.
JZ469796;
CCPd_EST_647 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469797; SV 1; linear; mRNA; EST; PLN; 740 BP.
JZ469797;
CCPd_EST_65 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469798; SV 1; linear; mRNA; EST; PLN; 468 BP.
JZ469798;
CCPd_EST_650 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469799; SV 1; linear; mRNA; EST; PLN; 156 BP.
JZ469799;
CCPd_EST_651 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469800; SV 1; linear; mRNA; EST; PLN; 245 BP.
JZ469800;
CCPd_EST_653 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469801; SV 1; linear; mRNA; EST; PLN; 137 BP.
JZ469801;
CCPd_EST_655 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469802; SV 1; linear; mRNA; EST; PLN; 127 BP.
JZ469802;
CCPd_EST_656 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469803; SV 1; linear; mRNA; EST; PLN; 260 BP.
JZ469803;
CCPd_EST_657 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469804; SV 1; linear; mRNA; EST; PLN; 462 BP.
JZ469804;
CCPd_EST_658 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469805; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469805;
CCPd_EST_659 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469806; SV 1; linear; mRNA; EST; PLN; 495 BP.
JZ469806;
CCPd_EST_66 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469807; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469807;
CCPd_EST_661 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469808; SV 1; linear; mRNA; EST; PLN; 575 BP.
JZ469808;
CCPd_EST_662 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469809; SV 1; linear; mRNA; EST; PLN; 346 BP.
JZ469809;
CCPd_EST_663 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469810; SV 1; linear; mRNA; EST; PLN; 368 BP.
JZ469810;
CCPd_EST_664 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469811; SV 1; linear; mRNA; EST; PLN; 252 BP.
JZ469811;
CCPd_EST_665 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469812; SV 1; linear; mRNA; EST; PLN; 519 BP.
JZ469812;
CCPd_EST_666 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469813; SV 1; linear; mRNA; EST; PLN; 477 BP.
JZ469813;
CCPd_EST_668 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469814; SV 1; linear; mRNA; EST; PLN; 346 BP.
JZ469814;
CCPd_EST_669 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469815; SV 1; linear; mRNA; EST; PLN; 289 BP.
JZ469815;
CCPd_EST_670 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469816; SV 1; linear; mRNA; EST; PLN; 177 BP.
JZ469816;
CCPd_EST_671 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469817; SV 1; linear; mRNA; EST; PLN; 174 BP.
JZ469817;
CCPd_EST_672 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469818; SV 1; linear; mRNA; EST; PLN; 381 BP.
JZ469818;
CCPd_EST_673 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469819; SV 1; linear; mRNA; EST; PLN; 238 BP.
JZ469819;
CCPd_EST_674 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469820; SV 1; linear; mRNA; EST; PLN; 516 BP.
JZ469820;
CCPd_EST_675 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469821; SV 1; linear; mRNA; EST; PLN; 574 BP.
JZ469821;
CCPd_EST_676 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469822; SV 1; linear; mRNA; EST; PLN; 205 BP.
JZ469822;
CCPd_EST_679 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469823; SV 1; linear; mRNA; EST; PLN; 238 BP.
JZ469823;
CCPd_EST_68 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469824; SV 1; linear; mRNA; EST; PLN; 261 BP.
JZ469824;
CCPd_EST_680 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469825; SV 1; linear; mRNA; EST; PLN; 158 BP.
JZ469825;
CCPd_EST_681 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469826; SV 1; linear; mRNA; EST; PLN; 536 BP.
JZ469826;
CCPd_EST_682 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469827; SV 1; linear; mRNA; EST; PLN; 349 BP.
JZ469827;
CCPd_EST_683 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469828; SV 1; linear; mRNA; EST; PLN; 335 BP.
JZ469828;
CCPd_EST_684 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469829; SV 1; linear; mRNA; EST; PLN; 162 BP.
JZ469829;
CCPd_EST_685 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469830; SV 1; linear; mRNA; EST; PLN; 142 BP.
JZ469830;
CCPd_EST_686 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469831; SV 1; linear; mRNA; EST; PLN; 317 BP.
JZ469831;
CCPd_EST_689 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469832; SV 1; linear; mRNA; EST; PLN; 284 BP.
JZ469832;
CCPd_EST_69 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469833; SV 1; linear; mRNA; EST; PLN; 369 BP.
JZ469833;
CCPd_EST_690 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469834; SV 1; linear; mRNA; EST; PLN; 433 BP.
JZ469834;
CCPd_EST_691 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469835; SV 1; linear; mRNA; EST; PLN; 262 BP.
JZ469835;
CCPd_EST_692 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469836; SV 1; linear; mRNA; EST; PLN; 370 BP.
JZ469836;
CCPd_EST_693 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469837; SV 1; linear; mRNA; EST; PLN; 415 BP.
JZ469837;
CCPd_EST_694 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469838; SV 1; linear; mRNA; EST; PLN; 707 BP.
JZ469838;
CCPd_EST_695 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469839; SV 1; linear; mRNA; EST; PLN; 156 BP.
JZ469839;
CCPd_EST_696 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469840; SV 1; linear; mRNA; EST; PLN; 983 BP.
JZ469840;
CCPd_EST_70 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469841; SV 1; linear; mRNA; EST; PLN; 291 BP.
JZ469841;
CCPd_EST_700 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469842; SV 1; linear; mRNA; EST; PLN; 627 BP.
JZ469842;
CCPd_EST_702 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469843; SV 1; linear; mRNA; EST; PLN; 201 BP.
JZ469843;
CCPd_EST_703 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469844; SV 1; linear; mRNA; EST; PLN; 560 BP.
JZ469844;
CCPd_EST_704 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469845; SV 1; linear; mRNA; EST; PLN; 670 BP.
JZ469845;
CCPd_EST_706 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469846; SV 1; linear; mRNA; EST; PLN; 731 BP.
JZ469846;
CCPd_EST_707 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469847; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469847;
CCPd_EST_708 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469848; SV 1; linear; mRNA; EST; PLN; 406 BP.
JZ469848;
CCPd_EST_709 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469849; SV 1; linear; mRNA; EST; PLN; 303 BP.
JZ469849;
CCPd_EST_71 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469850; SV 1; linear; mRNA; EST; PLN; 320 BP.
JZ469850;
CCPd_EST_710 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469851; SV 1; linear; mRNA; EST; PLN; 316 BP.
JZ469851;
CCPd_EST_711 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469852; SV 1; linear; mRNA; EST; PLN; 422 BP.
JZ469852;
CCPd_EST_714 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469853; SV 1; linear; mRNA; EST; PLN; 271 BP.
JZ469853;
CCPd_EST_716 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469854; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469854;
CCPd_EST_717 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469855; SV 1; linear; mRNA; EST; PLN; 392 BP.
JZ469855;
CCPd_EST_718 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469856; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469856;
CCPd_EST_719 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469857; SV 1; linear; mRNA; EST; PLN; 276 BP.
JZ469857;
CCPd_EST_72 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469858; SV 1; linear; mRNA; EST; PLN; 575 BP.
JZ469858;
CCPd_EST_720 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469859; SV 1; linear; mRNA; EST; PLN; 357 BP.
JZ469859;
CCPd_EST_721 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469860; SV 1; linear; mRNA; EST; PLN; 280 BP.
JZ469860;
CCPd_EST_723 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469861; SV 1; linear; mRNA; EST; PLN; 310 BP.
JZ469861;
CCPd_EST_724 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469862; SV 1; linear; mRNA; EST; PLN; 417 BP.
JZ469862;
CCPd_EST_726 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469863; SV 1; linear; mRNA; EST; PLN; 280 BP.
JZ469863;
CCPd_EST_728 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469864; SV 1; linear; mRNA; EST; PLN; 180 BP.
JZ469864;
CCPd_EST_729 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469865; SV 1; linear; mRNA; EST; PLN; 309 BP.
JZ469865;
CCPd_EST_73 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469866; SV 1; linear; mRNA; EST; PLN; 456 BP.
JZ469866;
CCPd_EST_731 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469867; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469867;
CCPd_EST_732 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469868; SV 1; linear; mRNA; EST; PLN; 969 BP.
JZ469868;
CCPd_EST_734 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469869; SV 1; linear; mRNA; EST; PLN; 377 BP.
JZ469869;
CCPd_EST_736 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469870; SV 1; linear; mRNA; EST; PLN; 433 BP.
JZ469870;
CCPd_EST_737 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469871; SV 1; linear; mRNA; EST; PLN; 561 BP.
JZ469871;
CCPd_EST_738 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469872; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469872;
CCPd_EST_739 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469873; SV 1; linear; mRNA; EST; PLN; 433 BP.
JZ469873;
CCPd_EST_74 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469874; SV 1; linear; mRNA; EST; PLN; 161 BP.
JZ469874;
CCPd_EST_740 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469875; SV 1; linear; mRNA; EST; PLN; 677 BP.
JZ469875;
CCPd_EST_741 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469876; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469876;
CCPd_EST_745 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469877; SV 1; linear; mRNA; EST; PLN; 394 BP.
JZ469877;
CCPd_EST_746 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469878; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ469878;
CCPd_EST_747 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469879; SV 1; linear; mRNA; EST; PLN; 215 BP.
JZ469879;
CCPd_EST_749 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469880; SV 1; linear; mRNA; EST; PLN; 393 BP.
JZ469880;
CCPd_EST_75 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469881; SV 1; linear; mRNA; EST; PLN; 558 BP.
JZ469881;
CCPd_EST_750 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469882; SV 1; linear; mRNA; EST; PLN; 334 BP.
JZ469882;
CCPd_EST_752 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469883; SV 1; linear; mRNA; EST; PLN; 178 BP.
JZ469883;
CCPd_EST_753 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469884; SV 1; linear; mRNA; EST; PLN; 680 BP.
JZ469884;
CCPd_EST_754 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469885; SV 1; linear; mRNA; EST; PLN; 394 BP.
JZ469885;
CCPd_EST_755 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469886; SV 1; linear; mRNA; EST; PLN; 501 BP.
JZ469886;
CCPd_EST_756 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469887; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ469887;
CCPd_EST_757 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469888; SV 1; linear; mRNA; EST; PLN; 769 BP.
JZ469888;
CCPd_EST_758 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469889; SV 1; linear; mRNA; EST; PLN; 143 BP.
JZ469889;
CCPd_EST_759 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469890; SV 1; linear; mRNA; EST; PLN; 245 BP.
JZ469890;
CCPd_EST_76 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469891; SV 1; linear; mRNA; EST; PLN; 212 BP.
JZ469891;
CCPd_EST_760 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469892; SV 1; linear; mRNA; EST; PLN; 360 BP.
JZ469892;
CCPd_EST_761 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469893; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ469893;
CCPd_EST_762 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469894; SV 1; linear; mRNA; EST; PLN; 292 BP.
JZ469894;
CCPd_EST_763 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469895; SV 1; linear; mRNA; EST; PLN; 260 BP.
JZ469895;
CCPd_EST_764 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469896; SV 1; linear; mRNA; EST; PLN; 262 BP.
JZ469896;
CCPd_EST_765 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469897; SV 1; linear; mRNA; EST; PLN; 271 BP.
JZ469897;
CCPd_EST_767 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469898; SV 1; linear; mRNA; EST; PLN; 220 BP.
JZ469898;
CCPd_EST_768 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469899; SV 1; linear; mRNA; EST; PLN; 175 BP.
JZ469899;
CCPd_EST_769 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469900; SV 1; linear; mRNA; EST; PLN; 309 BP.
JZ469900;
CCPd_EST_77 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469901; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469901;
CCPd_EST_771 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469902; SV 1; linear; mRNA; EST; PLN; 532 BP.
JZ469902;
CCPd_EST_772 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469903; SV 1; linear; mRNA; EST; PLN; 473 BP.
JZ469903;
CCPd_EST_773 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469904; SV 1; linear; mRNA; EST; PLN; 736 BP.
JZ469904;
CCPd_EST_774 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469905; SV 1; linear; mRNA; EST; PLN; 80 BP.
JZ469905;
CCPd_EST_777 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469906; SV 1; linear; mRNA; EST; PLN; 317 BP.
JZ469906;
CCPd_EST_778 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469907; SV 1; linear; mRNA; EST; PLN; 617 BP.
JZ469907;
CCPd_EST_779 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469908; SV 1; linear; mRNA; EST; PLN; 236 BP.
JZ469908;
CCPd_EST_78 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469909; SV 1; linear; mRNA; EST; PLN; 100 BP.
JZ469909;
CCPd_EST_782 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469910; SV 1; linear; mRNA; EST; PLN; 653 BP.
JZ469910;
CCPd_EST_783 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469911; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ469911;
CCPd_EST_784 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469912; SV 1; linear; mRNA; EST; PLN; 310 BP.
JZ469912;
CCPd_EST_785 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469913; SV 1; linear; mRNA; EST; PLN; 220 BP.
JZ469913;
CCPd_EST_786 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469914; SV 1; linear; mRNA; EST; PLN; 413 BP.
JZ469914;
CCPd_EST_788 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469915; SV 1; linear; mRNA; EST; PLN; 420 BP.
JZ469915;
CCPd_EST_789 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469916; SV 1; linear; mRNA; EST; PLN; 453 BP.
JZ469916;
CCPd_EST_79 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469917; SV 1; linear; mRNA; EST; PLN; 414 BP.
JZ469917;
CCPd_EST_792 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469918; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469918;
CCPd_EST_793 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469919; SV 1; linear; mRNA; EST; PLN; 515 BP.
JZ469919;
CCPd_EST_794 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469920; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ469920;
CCPd_EST_795 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469921; SV 1; linear; mRNA; EST; PLN; 434 BP.
JZ469921;
CCPd_EST_798 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469922; SV 1; linear; mRNA; EST; PLN; 511 BP.
JZ469922;
CCPd_EST_799 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469923; SV 1; linear; mRNA; EST; PLN; 395 BP.
JZ469923;
CCPd_EST_8 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469924; SV 1; linear; mRNA; EST; PLN; 443 BP.
JZ469924;
CCPd_EST_80 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469925; SV 1; linear; mRNA; EST; PLN; 209 BP.
JZ469925;
CCPd_EST_800 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469926; SV 1; linear; mRNA; EST; PLN; 132 BP.
JZ469926;
CCPd_EST_801 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469927; SV 1; linear; mRNA; EST; PLN; 366 BP.
JZ469927;
CCPd_EST_802 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469928; SV 1; linear; mRNA; EST; PLN; 476 BP.
JZ469928;
CCPd_EST_803 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469929; SV 1; linear; mRNA; EST; PLN; 334 BP.
JZ469929;
CCPd_EST_804 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469930; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ469930;
CCPd_EST_807 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469931; SV 1; linear; mRNA; EST; PLN; 734 BP.
JZ469931;
CCPd_EST_808 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469932; SV 1; linear; mRNA; EST; PLN; 370 BP.
JZ469932;
CCPd_EST_809 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469933; SV 1; linear; mRNA; EST; PLN; 120 BP.
JZ469933;
CCPd_EST_81 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469934; SV 1; linear; mRNA; EST; PLN; 475 BP.
JZ469934;
CCPd_EST_811 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469935; SV 1; linear; mRNA; EST; PLN; 242 BP.
JZ469935;
CCPd_EST_812 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469936; SV 1; linear; mRNA; EST; PLN; 323 BP.
JZ469936;
CCPd_EST_813 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469937; SV 1; linear; mRNA; EST; PLN; 508 BP.
JZ469937;
CCPd_EST_814 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469938; SV 1; linear; mRNA; EST; PLN; 290 BP.
JZ469938;
CCPd_EST_816 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469939; SV 1; linear; mRNA; EST; PLN; 347 BP.
JZ469939;
CCPd_EST_817 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469940; SV 1; linear; mRNA; EST; PLN; 525 BP.
JZ469940;
CCPd_EST_818 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469941; SV 1; linear; mRNA; EST; PLN; 326 BP.
JZ469941;
CCPd_EST_819 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469942; SV 1; linear; mRNA; EST; PLN; 160 BP.
JZ469942;
CCPd_EST_82 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469943; SV 1; linear; mRNA; EST; PLN; 339 BP.
JZ469943;
CCPd_EST_821 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469944; SV 1; linear; mRNA; EST; PLN; 454 BP.
JZ469944;
CCPd_EST_822 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469945; SV 1; linear; mRNA; EST; PLN; 157 BP.
JZ469945;
CCPd_EST_824 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469946; SV 1; linear; mRNA; EST; PLN; 791 BP.
JZ469946;
CCPd_EST_826 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469947; SV 1; linear; mRNA; EST; PLN; 291 BP.
JZ469947;
CCPd_EST_827 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469948; SV 1; linear; mRNA; EST; PLN; 277 BP.
JZ469948;
CCPd_EST_828 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469949; SV 1; linear; mRNA; EST; PLN; 601 BP.
JZ469949;
CCPd_EST_83 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469950; SV 1; linear; mRNA; EST; PLN; 160 BP.
JZ469950;
CCPd_EST_830 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469951; SV 1; linear; mRNA; EST; PLN; 125 BP.
JZ469951;
CCPd_EST_831 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469952; SV 1; linear; mRNA; EST; PLN; 270 BP.
JZ469952;
CCPd_EST_832 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469953; SV 1; linear; mRNA; EST; PLN; 363 BP.
JZ469953;
CCPd_EST_833 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469954; SV 1; linear; mRNA; EST; PLN; 297 BP.
JZ469954;
CCPd_EST_835 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469955; SV 1; linear; mRNA; EST; PLN; 667 BP.
JZ469955;
CCPd_EST_836 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469956; SV 1; linear; mRNA; EST; PLN; 450 BP.
JZ469956;
CCPd_EST_837 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469957; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ469957;
CCPd_EST_838 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469958; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ469958;
CCPd_EST_839 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469959; SV 1; linear; mRNA; EST; PLN; 204 BP.
JZ469959;
CCPd_EST_84 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469960; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469960;
CCPd_EST_841 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469961; SV 1; linear; mRNA; EST; PLN; 501 BP.
JZ469961;
CCPd_EST_842 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469962; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ469962;
CCPd_EST_843 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469963; SV 1; linear; mRNA; EST; PLN; 281 BP.
JZ469963;
CCPd_EST_844 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469964; SV 1; linear; mRNA; EST; PLN; 188 BP.
JZ469964;
CCPd_EST_846 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469965; SV 1; linear; mRNA; EST; PLN; 209 BP.
JZ469965;
CCPd_EST_848 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469966; SV 1; linear; mRNA; EST; PLN; 456 BP.
JZ469966;
CCPd_EST_849 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469967; SV 1; linear; mRNA; EST; PLN; 204 BP.
JZ469967;
CCPd_EST_85 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469968; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ469968;
CCPd_EST_850 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469969; SV 1; linear; mRNA; EST; PLN; 462 BP.
JZ469969;
CCPd_EST_851 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469970; SV 1; linear; mRNA; EST; PLN; 329 BP.
JZ469970;
CCPd_EST_853 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469971; SV 1; linear; mRNA; EST; PLN; 185 BP.
JZ469971;
CCPd_EST_854 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469972; SV 1; linear; mRNA; EST; PLN; 491 BP.
JZ469972;
CCPd_EST_855 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469973; SV 1; linear; mRNA; EST; PLN; 160 BP.
JZ469973;
CCPd_EST_856 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469974; SV 1; linear; mRNA; EST; PLN; 188 BP.
JZ469974;
CCPd_EST_857 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469975; SV 1; linear; mRNA; EST; PLN; 365 BP.
JZ469975;
CCPd_EST_858 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469976; SV 1; linear; mRNA; EST; PLN; 215 BP.
JZ469976;
CCPd_EST_859 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469977; SV 1; linear; mRNA; EST; PLN; 298 BP.
JZ469977;
CCPd_EST_86 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469978; SV 1; linear; mRNA; EST; PLN; 545 BP.
JZ469978;
CCPd_EST_860 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469979; SV 1; linear; mRNA; EST; PLN; 260 BP.
JZ469979;
CCPd_EST_862 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469980; SV 1; linear; mRNA; EST; PLN; 124 BP.
JZ469980;
CCPd_EST_863 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469981; SV 1; linear; mRNA; EST; PLN; 220 BP.
JZ469981;
CCPd_EST_864 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469982; SV 1; linear; mRNA; EST; PLN; 329 BP.
JZ469982;
CCPd_EST_866 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469983; SV 1; linear; mRNA; EST; PLN; 923 BP.
JZ469983;
CCPd_EST_869 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469984; SV 1; linear; mRNA; EST; PLN; 663 BP.
JZ469984;
CCPd_EST_870 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469985; SV 1; linear; mRNA; EST; PLN; 315 BP.
JZ469985;
CCPd_EST_871 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469986; SV 1; linear; mRNA; EST; PLN; 442 BP.
JZ469986;
CCPd_EST_874 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469987; SV 1; linear; mRNA; EST; PLN; 389 BP.
JZ469987;
CCPd_EST_875 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469988; SV 1; linear; mRNA; EST; PLN; 387 BP.
JZ469988;
CCPd_EST_876 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469989; SV 1; linear; mRNA; EST; PLN; 228 BP.
JZ469989;
CCPd_EST_878 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469990; SV 1; linear; mRNA; EST; PLN; 595 BP.
JZ469990;
CCPd_EST_88 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469991; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ469991;
CCPd_EST_880 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469992; SV 1; linear; mRNA; EST; PLN; 203 BP.
JZ469992;
CCPd_EST_881 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469993; SV 1; linear; mRNA; EST; PLN; 720 BP.
JZ469993;
CCPd_EST_882 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469994; SV 1; linear; mRNA; EST; PLN; 304 BP.
JZ469994;
CCPd_EST_883 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469995; SV 1; linear; mRNA; EST; PLN; 1039 BP.
JZ469995;
CCPd_EST_884 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469996; SV 1; linear; mRNA; EST; PLN; 456 BP.
JZ469996;
CCPd_EST_886 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469997; SV 1; linear; mRNA; EST; PLN; 510 BP.
JZ469997;
CCPd_EST_888 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469998; SV 1; linear; mRNA; EST; PLN; 536 BP.
JZ469998;
CCPd_EST_889 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ469999; SV 1; linear; mRNA; EST; PLN; 245 BP.
JZ469999;
CCPd_EST_89 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470000; SV 1; linear; mRNA; EST; PLN; 330 BP.
JZ470000;
CCPd_EST_890 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470001; SV 1; linear; mRNA; EST; PLN; 255 BP.
JZ470001;
CCPd_EST_891 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470002; SV 1; linear; mRNA; EST; PLN; 400 BP.
JZ470002;
CCPd_EST_892 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470003; SV 1; linear; mRNA; EST; PLN; 177 BP.
JZ470003;
CCPd_EST_893 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470004; SV 1; linear; mRNA; EST; PLN; 257 BP.
JZ470004;
CCPd_EST_894 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470005; SV 1; linear; mRNA; EST; PLN; 510 BP.
JZ470005;
CCPd_EST_898 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470006; SV 1; linear; mRNA; EST; PLN; 492 BP.
JZ470006;
CCPd_EST_899 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470007; SV 1; linear; mRNA; EST; PLN; 178 BP.
JZ470007;
CCPd_EST_90 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470008; SV 1; linear; mRNA; EST; PLN; 271 BP.
JZ470008;
CCPd_EST_900 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470009; SV 1; linear; mRNA; EST; PLN; 334 BP.
JZ470009;
CCPd_EST_901 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470010; SV 1; linear; mRNA; EST; PLN; 125 BP.
JZ470010;
CCPd_EST_902 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470011; SV 1; linear; mRNA; EST; PLN; 643 BP.
JZ470011;
CCPd_EST_903 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470012; SV 1; linear; mRNA; EST; PLN; 231 BP.
JZ470012;
CCPd_EST_904 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470013; SV 1; linear; mRNA; EST; PLN; 141 BP.
JZ470013;
CCPd_EST_905 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470014; SV 1; linear; mRNA; EST; PLN; 348 BP.
JZ470014;
CCPd_EST_906 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470015; SV 1; linear; mRNA; EST; PLN; 477 BP.
JZ470015;
CCPd_EST_907 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470016; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ470016;
CCPd_EST_909 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470017; SV 1; linear; mRNA; EST; PLN; 275 BP.
JZ470017;
CCPd_EST_91 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470018; SV 1; linear; mRNA; EST; PLN; 275 BP.
JZ470018;
CCPd_EST_910 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470019; SV 1; linear; mRNA; EST; PLN; 428 BP.
JZ470019;
CCPd_EST_911 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470020; SV 1; linear; mRNA; EST; PLN; 180 BP.
JZ470020;
CCPd_EST_912 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470021; SV 1; linear; mRNA; EST; PLN; 310 BP.
JZ470021;
CCPd_EST_914 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470022; SV 1; linear; mRNA; EST; PLN; 182 BP.
JZ470022;
CCPd_EST_915 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470023; SV 1; linear; mRNA; EST; PLN; 360 BP.
JZ470023;
CCPd_EST_916 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470024; SV 1; linear; mRNA; EST; PLN; 451 BP.
JZ470024;
CCPd_EST_917 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470025; SV 1; linear; mRNA; EST; PLN; 200 BP.
JZ470025;
CCPd_EST_92 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470026; SV 1; linear; mRNA; EST; PLN; 120 BP.
JZ470026;
CCPd_EST_920 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470027; SV 1; linear; mRNA; EST; PLN; 570 BP.
JZ470027;
CCPd_EST_921 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470028; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ470028;
CCPd_EST_922 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470029; SV 1; linear; mRNA; EST; PLN; 464 BP.
JZ470029;
CCPd_EST_923 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470030; SV 1; linear; mRNA; EST; PLN; 410 BP.
JZ470030;
CCPd_EST_924 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470031; SV 1; linear; mRNA; EST; PLN; 1136 BP.
JZ470031;
CCPd_EST_925 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470032; SV 1; linear; mRNA; EST; PLN; 361 BP.
JZ470032;
CCPd_EST_927 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470033; SV 1; linear; mRNA; EST; PLN; 420 BP.
JZ470033;
CCPd_EST_929 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470034; SV 1; linear; mRNA; EST; PLN; 279 BP.
JZ470034;
CCPd_EST_930 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470035; SV 1; linear; mRNA; EST; PLN; 350 BP.
JZ470035;
CCPd_EST_931 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470036; SV 1; linear; mRNA; EST; PLN; 863 BP.
JZ470036;
CCPd_EST_932 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470037; SV 1; linear; mRNA; EST; PLN; 598 BP.
JZ470037;
CCPd_EST_933 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470038; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ470038;
CCPd_EST_937 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470039; SV 1; linear; mRNA; EST; PLN; 170 BP.
JZ470039;
CCPd_EST_938 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470040; SV 1; linear; mRNA; EST; PLN; 284 BP.
JZ470040;
CCPd_EST_94 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470041; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ470041;
CCPd_EST_940 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470042; SV 1; linear; mRNA; EST; PLN; 550 BP.
JZ470042;
CCPd_EST_941 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470043; SV 1; linear; mRNA; EST; PLN; 477 BP.
JZ470043;
CCPd_EST_943 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470044; SV 1; linear; mRNA; EST; PLN; 396 BP.
JZ470044;
CCPd_EST_944 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470045; SV 1; linear; mRNA; EST; PLN; 191 BP.
JZ470045;
CCPd_EST_945 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470046; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ470046;
CCPd_EST_947 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470047; SV 1; linear; mRNA; EST; PLN; 267 BP.
JZ470047;
CCPd_EST_948 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470048; SV 1; linear; mRNA; EST; PLN; 650 BP.
JZ470048;
CCPd_EST_949 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470049; SV 1; linear; mRNA; EST; PLN; 208 BP.
JZ470049;
CCPd_EST_95 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470050; SV 1; linear; mRNA; EST; PLN; 360 BP.
JZ470050;
CCPd_EST_951 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470051; SV 1; linear; mRNA; EST; PLN; 322 BP.
JZ470051;
CCPd_EST_952 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470052; SV 1; linear; mRNA; EST; PLN; 333 BP.
JZ470052;
CCPd_EST_953 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470053; SV 1; linear; mRNA; EST; PLN; 500 BP.
JZ470053;
CCPd_EST_955 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470054; SV 1; linear; mRNA; EST; PLN; 210 BP.
JZ470054;
CCPd_EST_96 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470055; SV 1; linear; mRNA; EST; PLN; 296 BP.
JZ470055;
CCPd_EST_960 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470056; SV 1; linear; mRNA; EST; PLN; 336 BP.
JZ470056;
CCPd_EST_961 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470057; SV 1; linear; mRNA; EST; PLN; 396 BP.
JZ470057;
CCPd_EST_962 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470058; SV 1; linear; mRNA; EST; PLN; 201 BP.
JZ470058;
CCPd_EST_963 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470059; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ470059;
CCPd_EST_965 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470060; SV 1; linear; mRNA; EST; PLN; 260 BP.
JZ470060;
CCPd_EST_966 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470061; SV 1; linear; mRNA; EST; PLN; 185 BP.
JZ470061;
CCPd_EST_967 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470062; SV 1; linear; mRNA; EST; PLN; 587 BP.
JZ470062;
CCPd_EST_969 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470063; SV 1; linear; mRNA; EST; PLN; 360 BP.
JZ470063;
CCPd_EST_971 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470064; SV 1; linear; mRNA; EST; PLN; 775 BP.
JZ470064;
CCPd_EST_972 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470065; SV 1; linear; mRNA; EST; PLN; 396 BP.
JZ470065;
CCPd_EST_973 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470066; SV 1; linear; mRNA; EST; PLN; 380 BP.
JZ470066;
CCPd_EST_974 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470067; SV 1; linear; mRNA; EST; PLN; 600 BP.
JZ470067;
CCPd_EST_975 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470068; SV 1; linear; mRNA; EST; PLN; 384 BP.
JZ470068;
CCPd_EST_976 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470069; SV 1; linear; mRNA; EST; PLN; 610 BP.
JZ470069;
CCPd_EST_977 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470070; SV 1; linear; mRNA; EST; PLN; 365 BP.
JZ470070;
CCPd_EST_978 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470071; SV 1; linear; mRNA; EST; PLN; 538 BP.
JZ470071;
CCPd_EST_979 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470072; SV 1; linear; mRNA; EST; PLN; 292 BP.
JZ470072;
CCPd_EST_98 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470073; SV 1; linear; mRNA; EST; PLN; 245 BP.
JZ470073;
CCPd_EST_981 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470074; SV 1; linear; mRNA; EST; PLN; 178 BP.
JZ470074;
CCPd_EST_982 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470075; SV 1; linear; mRNA; EST; PLN; 394 BP.
JZ470075;
CCPd_EST_983 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470076; SV 1; linear; mRNA; EST; PLN; 491 BP.
JZ470076;
CCPd_EST_984 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470077; SV 1; linear; mRNA; EST; PLN; 250 BP.
JZ470077;
CCPd_EST_985 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470078; SV 1; linear; mRNA; EST; PLN; 109 BP.
JZ470078;
CCPd_EST_986 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470079; SV 1; linear; mRNA; EST; PLN; 205 BP.
JZ470079;
CCPd_EST_987 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470080; SV 1; linear; mRNA; EST; PLN; 432 BP.
JZ470080;
CCPd_EST_988 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470081; SV 1; linear; mRNA; EST; PLN; 300 BP.
JZ470081;
CCPd_EST_989 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470082; SV 1; linear; mRNA; EST; PLN; 438 BP.
JZ470082;
CCPd_EST_99 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470083; SV 1; linear; mRNA; EST; PLN; 137 BP.
JZ470083;
CCPd_EST_990 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470084; SV 1; linear; mRNA; EST; PLN; 623 BP.
JZ470084;
CCPd_EST_994 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470085; SV 1; linear; mRNA; EST; PLN; 258 BP.
JZ470085;
CCPd_EST_996 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.

JZ470086; SV 1; linear; mRNA; EST; PLN; 363 BP.
JZ470086;
CCPd_EST_999 Piriformospora indica colonized with Chinese cabbage roots library Brassica rapa subsp. chinensis cDNA, mRNA sequence.


03/02/2014

KF797913; SV 1; linear; mRNA; STD; PLN; 607 BP.
KF797913;
Brassica oleracea flowering locus C (FLC-y1) mRNA, FLC-y1-FLC3 allele, complete cds.

KF797914; SV 1; linear; mRNA; STD; PLN; 607 BP.
KF797914;
Brassica oleracea flowering locus C (FLC-y2) mRNA, FLC-y2-FLC3 allele, complete cds.

KF797915; SV 1; linear; mRNA; STD; PLN; 604 BP.
KF797915;
Brassica oleracea flowering locus C (FLC-y3) mRNA, FLC-y3-FLC4 allele, complete cds.

KF797916; SV 1; linear; mRNA; STD; PLN; 607 BP.
KF797916;
Brassica oleracea flowering locus C (FLC-y4) mRNA, FLC-y4-FLC3 allele, complete cds.

KF797917; SV 1; linear; mRNA; STD; PLN; 604 BP.
KF797917;
Brassica oleracea flowering locus C (FLC-y5) mRNA, FLC-y5-FLC4 allele, complete cds.


01/02/2014

JN806156; SV 1; linear; mRNA; STD; PLN; 1254 BP.
JN806156;
Brassica napus PHR1 (PHR1) mRNA, complete cds.


29/01/2014

KC121342; SV 1; linear; genomic DNA; STD; PLN; 2138 BP.
KC121342;
Brassica rapa nonfunctional AP2 variant 4 (AP2) gene, complete sequence; alternatively spliced.

KC121343; SV 1; linear; genomic DNA; STD; PLN; 2164 BP.
KC121343;
Brassica rapa AP2 variant 1 (AP2) gene, complete cds, alternatively spliced.


18/01/2014

AB901369; SV 1; linear; mRNA; STD; PLN; 753 BP.
AB901369;
Brassica rapa subsp. pekinensis APX mRNA for ascorbate peroxidase, complete cds, clone: BcAPX1.

AB901370; SV 1; linear; mRNA; STD; PLN; 753 BP.
AB901370;
Brassica rapa subsp. pekinensis APX mRNA for ascorbate peroxidase, complete cds, clone: BcAPX2.

AB901371; SV 1; linear; mRNA; STD; PLN; 753 BP.
AB901371;
Brassica rapa subsp. pekinensis APX mRNA for ascorbate peroxidase, complete cds, clone: BcAPX3.


16/01/2014

JQ708046; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ708046;
Brassica napus calcineurin B-like 1.1 (CBL1.1) mRNA, complete cds.

JQ708047; SV 1; linear; mRNA; STD; PLN; 750 BP.
JQ708047;
Brassica napus calcineurin B-like 10.1 (CBL10.1) mRNA, complete cds.

JQ708048; SV 1; linear; mRNA; STD; PLN; 681 BP.
JQ708048;
Brassica napus calcineurin B-like 2.1 (CBL2.1) mRNA, complete cds.

JQ708049; SV 1; linear; mRNA; STD; PLN; 681 BP.
JQ708049;
Brassica napus calcineurin B-like 3.1 (CBL3.1) mRNA, complete cds.

JQ708050; SV 1; linear; mRNA; STD; PLN; 666 BP.
JQ708050;
Brassica napus calcineurin B-like 4.1 (CBL4.1) mRNA, complete cds.

JQ708051; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ708051;
Brassica napus calcineurin B-like 9.1 (CBL9.1) mRNA, complete cds.

JQ708052; SV 1; linear; mRNA; STD; PLN; 1335 BP.
JQ708052;
Brassica napus CBL-interacting protein kinase 1.1 (CIPK1.1) mRNA, complete cds.

JQ708053; SV 1; linear; mRNA; STD; PLN; 1394 BP.
JQ708053;
Brassica napus CBL-interacting protein kinase 10.1 (CIPK10.1) mRNA, complete cds.

JQ708054; SV 1; linear; mRNA; STD; PLN; 1332 BP.
JQ708054;
Brassica napus CBL-interacting protein kinase 11.1 (CIPK11.1) mRNA, complete cds.

JQ708055; SV 1; linear; mRNA; STD; PLN; 1476 BP.
JQ708055;
Brassica napus CBL-interacting protein kinase 12.1 (CIPK12.1) mRNA, complete cds.

JQ708056; SV 1; linear; mRNA; STD; PLN; 1272 BP.
JQ708056;
Brassica napus CBL-interacting protein kinase 15.1 (CIPK15.1) mRNA, complete cds.

JQ708057; SV 1; linear; mRNA; STD; PLN; 1285 BP.
JQ708057;
Brassica napus CBL-interacting protein kinase 17.1 (CIPK17.1) mRNA, complete cds.

JQ708058; SV 1; linear; mRNA; STD; PLN; 1449 BP.
JQ708058;
Brassica napus CBL-interacting protein kinase 23.1 (CIPK23.1) mRNA, complete cds.

JQ708059; SV 1; linear; mRNA; STD; PLN; 1362 BP.
JQ708059;
Brassica napus CBL-interacting protein kinase 24.1 (CIPK24.1) mRNA, complete cds.

JQ708060; SV 1; linear; mRNA; STD; PLN; 1326 BP.
JQ708060;
Brassica napus CBL-interacting protein kinase 26.1 (CIPK26.1) mRNA, complete cds.

JQ708061; SV 1; linear; mRNA; STD; PLN; 1322 BP.
JQ708061;
Brassica napus CBL-interacting protein kinase 3.1 (CIPK3.1) mRNA, partial cds.

JQ708062; SV 1; linear; mRNA; STD; PLN; 1296 BP.
JQ708062;
Brassica napus CBL-interacting protein kinase 5.1 (CIPK5.1) mRNA, complete cds.

JQ708063; SV 1; linear; mRNA; STD; PLN; 1314 BP.
JQ708063;
Brassica napus CBL-interacting protein kinase 6.1 (CIPK6.1) mRNA, complete cds.

JQ708064; SV 1; linear; mRNA; STD; PLN; 1245 BP.
JQ708064;
Brassica napus CBL-interacting protein kinase 7.1 (CIPK7.1) mRNA, complete cds.

JQ708065; SV 1; linear; mRNA; STD; PLN; 1356 BP.
JQ708065;
Brassica napus CBL-interacting protein kinase 8.1 (CIPK8.1) mRNA, complete cds.

JQ708066; SV 1; linear; mRNA; STD; PLN; 1347 BP.
JQ708066;
Brassica napus CBL-interacting protein kinase 9.1 (CIPK9.1) mRNA, complete cds. FT                   PNLMTLYKRICKAEFNCPPWFSPGAKNVIKRILDPSPITRISIAELLEDEWFKQGYKTP

KC414027; SV 1; linear; mRNA; STD; PLN; 1318 BP.
KC414027;
Brassica napus CBL-interacting protein kinase 14 (CIPK14.1) mRNA, complete cds.

KC414028; SV 1; linear; mRNA; STD; PLN; 1368 BP.
KC414028;
Brassica napus CBL-interacting protein kinase 25 (CIPK25.1) mRNA, complete cds.


15/01/2014

JX306690; SV 1; linear; mRNA; STD; PLN; 1279 BP.
JX306690;
Brassica napus clone MPIZp1022G0813Q glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306691; SV 1; linear; mRNA; STD; PLN; 950 BP.
JX306691;
Brassica napus clone MPIZp1022A1123Q glutamine synthetase 1 (GLN1.5) mRNA, partial cds.

JX306692; SV 1; linear; mRNA; STD; PLN; 1178 BP.
JX306692;
Brassica napus clone MPIZp1022C0924Q glutamine synthetase 1 (GLN1.4) mRNA, partial sequence.

JX306693; SV 1; linear; mRNA; STD; PLN; 1218 BP.
JX306693;
Brassica napus clone BN20.052B22 glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306694; SV 1; linear; mRNA; STD; PLN; 1257 BP.
JX306694;
Brassica napus clone BN40.043K19 glutamine synthetase 1 (GLN1.3) mRNA, complete cds.

JX306695; SV 1; linear; mRNA; STD; PLN; 1309 BP.
JX306695;
Brassica napus clone BN15.001A07 glutamine synthetase 1 (GLN1.4) mRNA, complete cds.

JX306696; SV 1; linear; mRNA; STD; PLN; 1104 BP.
JX306696;
Brassica napus clone BnGS_Gln1-4_61_G4_c1 glutamine synthetase 1 (GLN1.4) mRNA, complete sequence.

JX306697; SV 1; linear; mRNA; STD; PLN; 1103 BP.
JX306697;
Brassica napus clone BnGS_Gln1-4_61_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, complete cds.

JX306698; SV 1; linear; mRNA; STD; PLN; 784 BP.
JX306698;
Brassica napus clone BnGS1.63_G4_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306699; SV 1; linear; mRNA; STD; PLN; 784 BP.
JX306699;
Brassica napus clone BnGS1.63_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306700; SV 1; linear; mRNA; STD; PLN; 758 BP.
JX306700;
Brassica napus clone BnGS1.64_G4_c2 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306701; SV 1; linear; mRNA; STD; PLN; 758 BP.
JX306701;
Brassica napus clone BnGS1.64_G9_c1 glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306702; SV 1; linear; mRNA; STD; PLN; 411 BP.
JX306702;
Brassica napus glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306703; SV 1; linear; mRNA; STD; PLN; 371 BP.
JX306703;
Brassica napus glutamine synthetase 1 (GLN1.4) mRNA, partial cds.

JX306704; SV 1; linear; genomic DNA; STD; PLN; 1685 BP.
JX306704;
Brassica napus clone BnGS1-63-T_ADNg3 glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306705; SV 1; linear; genomic DNA; STD; PLN; 1685 BP.
JX306705;
Brassica napus clone BnGS1-63-E_ADNg3 glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306706; SV 1; linear; genomic DNA; STD; PLN; 1699 BP.
JX306706;
Brassica napus clone BnGS1-64-E glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306707; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
JX306707;
Brassica napus clone BnGS1-63-T_2U-3L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306708; SV 1; linear; genomic DNA; STD; PLN; 1205 BP.
JX306708;
Brassica napus clone BnGS1-63-E_2U-3L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306709; SV 1; linear; genomic DNA; STD; PLN; 1181 BP.
JX306709;
Brassica napus clone BnGS1-64-E_2U-2L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306710; SV 1; linear; genomic DNA; STD; PLN; 1184 BP.
JX306710;
Brassica napus clone BnGS1-64-Dn_2U-2L glutamine synthetase 1 (GLN1.4) gene, partial cds.

JX306711; SV 1; linear; genomic DNA; STD; PLN; 1610 BP.
JX306711;
Brassica napus clone BnGS1-64-Dn_5U-5L glutamine synthetase 1 (GLN1.4) gene, partial cds.


09/01/2014

KF577723; SV 1; linear; mRNA; STD; PLN; 1281 BP.
KF577723;
Brassica oleracea var. capitata ABA insensitive 1 mRNA, complete cds.


08/01/2014

KF297329; SV 1; linear; mRNA; STD; PLN; 1251 BP.
KF297329;
Brassica napus isolate BnaC.PSY.f phytoene synthase mRNA, complete cds.

KF297330; SV 1; linear; mRNA; STD; PLN; 1742 BP.
KF297330;
Brassica napus isolate BnaA.PSY.b phytoene synthase mRNA, complete cds.

KF297331; SV 1; linear; mRNA; STD; PLN; 1740 BP.
KF297331;
Brassica napus isolate BnaA.PSY.c phytoene synthase mRNA, complete cds.

KF297332; SV 1; linear; mRNA; STD; PLN; 1692 BP.
KF297332;
Brassica napus isolate BnaA.PSY.d phytoene synthase mRNA, complete cds.

KF297333; SV 1; linear; mRNA; STD; PLN; 1769 BP.
KF297333;
Brassica napus isolate BnaC.PSY.a phytoene synthase mRNA, complete cds.

KF297334; SV 1; linear; mRNA; STD; PLN; 1512 BP.
KF297334;
Brassica napus isolate BnaC.PSY.e phytoene synthase mRNA, complete cds.


07/01/2014

KF577724; SV 1; linear; mRNA; STD; PLN; 1089 BP.
KF577724;
Brassica oleracea var. capitata open stomata 1 isoform 1 mRNA, complete cds, alternatively spliced. FT                   PKNFKKTIHGILNVQYAIPDYVHISPECQHLISRIFVADSAKRISIPEVRNHEWFLKNL

KF577725; SV 1; linear; mRNA; STD; PLN; 960 BP.
KF577725;
Brassica oleracea var. capitata open stomata 1 isoform 2 mRNA, complete cds, alternatively spliced.


03/01/2014

JQ317330; SV 1; linear; genomic DNA; STD; PLN; 1497 BP.
JQ317330;
Brassica rapa BrEXPA1 (EXPA1) gene, promoter region.

JQ708046; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ708046;
Brassica napus calcineurin B-like 1.1 (CBL1.1) mRNA, complete cds.

JQ708047; SV 1; linear; mRNA; STD; PLN; 750 BP.
JQ708047;
Brassica napus calcineurin B-like 10.1 (CBL10.1) mRNA, complete cds.

JQ708048; SV 1; linear; mRNA; STD; PLN; 681 BP.
JQ708048;
Brassica napus calcineurin B-like 2.1 (CBL2.1) mRNA, complete cds.

JQ708049; SV 1; linear; mRNA; STD; PLN; 681 BP.
JQ708049;
Brassica napus calcineurin B-like 3.1 (CBL3.1) mRNA, complete cds.

JQ708050; SV 1; linear; mRNA; STD; PLN; 666 BP.
JQ708050;
Brassica napus calcineurin B-like 4.1 (CBL4.1) mRNA, complete cds.

JQ708051; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ708051;
Brassica napus calcineurin B-like 9.1 (CBL9.1) mRNA, complete cds.

JQ708052; SV 1; linear; mRNA; STD; PLN; 1335 BP.
JQ708052;
Brassica napus CBL-interacting protein kinase 1.1 (CIPK1.1) mRNA, complete cds.

JQ708053; SV 1; linear; mRNA; STD; PLN; 1394 BP.
JQ708053;
Brassica napus CBL-interacting protein kinase 10.1 (CIPK10.1) mRNA, complete cds.

JQ708054; SV 1; linear; mRNA; STD; PLN; 1332 BP.
JQ708054;
Brassica napus CBL-interacting protein kinase 11.1 (CIPK11.1) mRNA, complete cds.

JQ708055; SV 1; linear; mRNA; STD; PLN; 1476 BP.
JQ708055;
Brassica napus CBL-interacting protein kinase 12.1 (CIPK12.1) mRNA, complete cds.

JQ708056; SV 1; linear; mRNA; STD; PLN; 1272 BP.
JQ708056;
Brassica napus CBL-interacting protein kinase 15.1 (CIPK15.1) mRNA, complete cds.

JQ708057; SV 1; linear; mRNA; STD; PLN; 1285 BP.
JQ708057;
Brassica napus CBL-interacting protein kinase 17.1 (CIPK17.1) mRNA, complete cds.

JQ708058; SV 1; linear; mRNA; STD; PLN; 1449 BP.
JQ708058;
Brassica napus CBL-interacting protein kinase 23.1 (CIPK23.1) mRNA, complete cds.

JQ708059; SV 1; linear; mRNA; STD; PLN; 1362 BP.
JQ708059;
Brassica napus CBL-interacting protein kinase 24.1 (CIPK24.1) mRNA, complete cds.

JQ708060; SV 1; linear; mRNA; STD; PLN; 1326 BP.
JQ708060;
Brassica napus CBL-interacting protein kinase 26.1 (CIPK26.1) mRNA, complete cds.

JQ708061; SV 1; linear; mRNA; STD; PLN; 1322 BP.
JQ708061;
Brassica napus CBL-interacting protein kinase 3.1 (CIPK3.1) mRNA, partial cds.

JQ708062; SV 1; linear; mRNA; STD; PLN; 1296 BP.
JQ708062;
Brassica napus CBL-interacting protein kinase 5.1 (CIPK5.1) mRNA, complete cds.

JQ708063; SV 1; linear; mRNA; STD; PLN; 1314 BP.
JQ708063;
Brassica napus CBL-interacting protein kinase 6.1 (CIPK6.1) mRNA, complete cds.

JQ708064; SV 1; linear; mRNA; STD; PLN; 1245 BP.
JQ708064;
Brassica napus CBL-interacting protein kinase 7.1 (CIPK7.1) mRNA, complete cds.

JQ708065; SV 1; linear; mRNA; STD; PLN; 1356 BP.
JQ708065;
Brassica napus CBL-interacting protein kinase 8.1 (CIPK8.1) mRNA, complete cds.

JQ708066; SV 1; linear; mRNA; STD; PLN; 1347 BP.
JQ708066;
Brassica napus CBL-interacting protein kinase 9.1 (CIPK9.1) mRNA, complete cds. FT                   PNLMTLYKRICKAEFNCPPWFSPGAKNVIKRILDPSPITRISIAELLEDEWFKQGYKTP

JQ708067; SV 1; linear; mRNA; STD; PLN; 3420 BP.
JQ708067;
Brassica napus Salt-overly-sensitive 1.1 (SOS1.1) mRNA, complete cds.

JQ845910; SV 1; linear; genomic DNA; STD; PLN; 2446 BP.
JQ845910;
Brassica napus cultivar GSC-5 MADS box transcription factor SOC1 gene, complete cds.

JQ845912; SV 1; linear; genomic DNA; STD; PLN; 2446 BP.
JQ845912;
Brassica rapa cultivar Ragini MADS box transcription factor SOC1 gene, complete cds.

JQ845913; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ845913;
Brassica rapa cultivar Ragini MADS box transcription factor SOC1 variant 16 mRNA, complete cds.

JQ845914; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ845914;
Brassica rapa cultivar YTS-151 MADS box transcription factor SOC1 variant 17 mRNA, complete cds.

JQ845921; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ845921;
Brassica rapa cultivar Pusa Gold MADS box transcription factor SOC1 variant 17 mRNA, complete cds.

JQ845927; SV 1; linear; mRNA; STD; PLN; 641 BP.
JQ845927;
Brassica rapa cultivar Sangam nonfunctional MADS box transcription factor SOC1 variant 1 mRNA, complete sequence.

JQ845928; SV 1; linear; mRNA; STD; PLN; 641 BP.
JQ845928;
Brassica rapa cultivar Sangam nonfunctional MADS box transcription factor SOC1 variant 2 mRNA, complete sequence.

JQ845929; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ845929;
Brassica napus cultivar GSC-5 MADS box transcription factor SOC1 variant 14 mRNA, complete cds.

JQ845930; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ845930;
Brassica napus cultivar GSC-5 MADS box transcription factor SOC1 variant 12 mRNA, complete cds.

JQ845931; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ845931;
Brassica napus cultivar GSC-5 MADS box transcription factor SOC1 variant 18 mRNA, complete cds.

JQ845932; SV 1; linear; mRNA; STD; PLN; 642 BP.
JQ845932;
Brassica napus cultivar GSL-1 MADS box transcription factor SOC1 variant 17 mRNA, complete cds.

KC190095; SV 1; linear; mRNA; STD; PLN; 1104 BP.
KC190095;
Brassica napus mitogen-activated protein kinase kinase kinase 17.1 (MAPKKK17.1) mRNA, complete cds.

KC190096; SV 1; linear; mRNA; STD; PLN; 1014 BP.
KC190096;
Brassica napus mitogen-activated protein kinase kinase kinase 18.1 (MAPKKK18.1) mRNA, complete cds.

KC190097; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KC190097;
Brassica napus mitogen-activated protein kinase kinase kinase 19.1 (MAPKKK19.1) mRNA, complete cds.

KC190098; SV 1; linear; mRNA; STD; PLN; 1029 BP.
KC190098;
Brassica napus mitogen-activated protein kinase kinase kinase 20.1 (MAPKKK20.1) mRNA, complete cds.

KC190099; SV 1; linear; mRNA; STD; PLN; 1686 BP.
KC190099;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK2.1 (ZIK2.1) mRNA, complete cds. FT                   NGMAKKVAFPFGIMNDTSVDVAMEMVKELEITDWDPVEIAEMIDGEISSLVPGWRYEEG

KC190100; SV 1; linear; mRNA; STD; PLN; 1701 BP.
KC190100;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK3.1 (ZIK3.1) mRNA, complete cds. FT                   YEGIEVAWNQVKLRNFTRNPEELEKFFREIHLLKTLNHQNIMKFYTSWVDTNNLAINFV

KC190101; SV 1; linear; mRNA; STD; PLN; 2037 BP.
KC190101;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK4.1 (ZIK4.1) mRNA, partial cds.

KC190102; SV 1; linear; mRNA; STD; PLN; 936 BP.
KC190102;
Brassica napus mitogen-activated protein kinase kinase kinase ZIK8.1 (ZIK8.1) mRNA, complete cds.

KC190103; SV 1; linear; mRNA; STD; PLN; 1317 BP.
KC190103;
Brassica napus mitogen-activated protein kinase kinase kinase Raf17.1 (Raf17.1) mRNA, complete cds.

KC190104; SV 1; linear; mRNA; STD; PLN; 1230 BP.
KC190104;
Brassica napus mitogen-activated protein kinase kinase kinase Raf28.1 (Raf28.1) mRNA, complete cds.

KC190105; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KC190105;
Brassica napus mitogen-activated protein kinase kinase kinase Raf29.1 (Raf29.1) mRNA, complete cds.

KC190106; SV 1; linear; mRNA; STD; PLN; 1704 BP.
KC190106;
Brassica napus mitogen-activated protein kinase kinase kinase Raf30.1 (Raf30.1) mRNA, complete cds.

KC190107; SV 1; linear; mRNA; STD; PLN; 1059 BP.
KC190107;
Brassica napus mitogen-activated protein kinase kinase kinase Raf34.1 (Raf34.1) mRNA, complete cds.

KC190108; SV 1; linear; mRNA; STD; PLN; 3189 BP.
KC190108;
Brassica napus mitogen-activated protein kinase kinase kinase Raf35.1 (Raf35.1) mRNA, complete cds.

KC190109; SV 1; linear; mRNA; STD; PLN; 1530 BP.
KC190109;
Brassica napus mitogen-activated protein kinase kinase kinase Raf36.1 (Raf36.1) mRNA, partial cds. FT                   NGCLGARLEKQFTKEVTLLSRLSHPNVIKFVGAYKDPPSYCVLTEYLPEGSLRSYLHKP

KC190110; SV 1; linear; mRNA; STD; PLN; 1137 BP.
KC190110;
Brassica napus mitogen-activated protein kinase kinase kinase Raf39.1 (Raf39.1) mRNA, complete cds.

KC246565; SV 1; linear; mRNA; STD; PLN; 1470 BP.
KC246565;
Brassica napus WRKY transcription factor 3.1 (WRKY3.1) mRNA, complete cds.

KC246566; SV 1; linear; mRNA; STD; PLN; 1461 BP.
KC246566;
Brassica napus WRKY transcription factor 3.2 (WRKY3.2) mRNA, complete cds.

KC246567; SV 1; linear; mRNA; STD; PLN; 1461 BP.
KC246567;
Brassica napus WRKY transcription factor 4.1 (WRKY4.1) mRNA, complete cds. FT                   PDAKRRSTEVRVSEPAAAAAASHRTVTEPRIIVQTTSEVDLLDDGYRWRKYGQKVVKGN

KC246568; SV 1; linear; mRNA; STD; PLN; 1659 BP.
KC246568;
Brassica napus WRKY transcription factor 6.1 (WRKY6.1) mRNA, complete cds.

KC246569; SV 1; linear; mRNA; STD; PLN; 954 BP.
KC246569;
Brassica napus WRKY transcription factor 8.1 (WRKY8.1) mRNA, complete cds.

KC246570; SV 1; linear; mRNA; STD; PLN; 1599 BP.
KC246570;
Brassica napus WRKY transcription factor 20.1 (WRKY20.1) mRNA, complete cds.

KC246571; SV 1; linear; mRNA; STD; PLN; 1599 BP.
KC246571;
Brassica napus WRKY transcription factor 20.2 (WRKY20.2) mRNA, complete cds.

KC246572; SV 1; linear; mRNA; STD; PLN; 966 BP.
KC246572;
Brassica napus WRKY transcription factor 26.1 (WRKY26.1) mRNA, complete cds.

KC246573; SV 1; linear; mRNA; STD; PLN; 1032 BP.
KC246573;
Brassica napus WRKY transcription factor 27.1 (WRKY27.1) mRNA, complete cds.

KC246574; SV 1; linear; mRNA; STD; PLN; 939 BP.
KC246574;
Brassica napus WRKY transcription factor 28.1 (WRKY28.1) mRNA, complete cds.

KC246575; SV 1; linear; mRNA; STD; PLN; 885 BP.
KC246575;
Brassica napus WRKY transcription factor 28.2 (WRKY28.2) mRNA, complete cds.

KC246576; SV 1; linear; mRNA; STD; PLN; 879 BP.
KC246576;
Brassica napus WRKY transcription factor 29.2 (WRKY29.2) mRNA, complete cds.

KC246577; SV 1; linear; mRNA; STD; PLN; 1620 BP.
KC246577;
Brassica napus WRKY transcription factor 31.1 (WRKY31.1) mRNA, complete cds.

KC246578; SV 1; linear; mRNA; STD; PLN; 1224 BP.
KC246578;
Brassica napus WRKY transcription factor 35.1 (WRKY35.1) mRNA, complete cds.

KC246579; SV 1; linear; mRNA; STD; PLN; 1560 BP.
KC246579;
Brassica napus WRKY transcription factor 42.1 (WRKY42.1) mRNA, complete cds.

KC246580; SV 1; linear; mRNA; STD; PLN; 435 BP.
KC246580;
Brassica napus WRKY transcription factor 45.1 (WRKY45.1) mRNA, complete cds.

KC246581; SV 1; linear; mRNA; STD; PLN; 951 BP.
KC246581;
Brassica napus WRKY transcription factor 53.1 (WRKY53.1) mRNA, complete cds.

KC246582; SV 1; linear; mRNA; STD; PLN; 990 BP.
KC246582;
Brassica napus WRKY transcription factor 53.2 (WRKY53.2) mRNA, complete cds.

KC246583; SV 1; linear; mRNA; STD; PLN; 840 BP.
KC246583;
Brassica napus WRKY transcription factor 69.1 (WRKY69.2) mRNA, complete cds. FT                   EEEEVTAAAEEPVGLDLSHVDSPLLLGGCYGELNEFGWFYDASISSSSGSSSYGGSFLD

KC246584; SV 1; linear; mRNA; STD; PLN; 840 BP.
KC246584;
Brassica napus WRKY transcription factor 69.2 (WRKY69.2) mRNA, complete cds. FT                   EEEEVTAAAEEPVGLDLSHVDSPLLLGGCYGELNEFGWFYDASISSSSGSSSYGGSFLD

KC246585; SV 1; linear; mRNA; STD; PLN; 1584 BP.
KC246585;
Brassica napus WRKY transcription factor 72.1 (WRKY72.1) mRNA, complete cds.

KC246586; SV 1; linear; mRNA; STD; PLN; 297 BP.
KC246586;
Brassica napus small ubiquitin-like modifier 1.1 (SUMO1.1) mRNA, complete cds.

KC246587; SV 1; linear; mRNA; STD; PLN; 315 BP.
KC246587;
Brassica napus small ubiquitin-like modifier 2.1 (SUMO2.1) mRNA, complete cds.

KC246588; SV 1; linear; mRNA; STD; PLN; 330 BP.
KC246588;
Brassica napus small ubiquitin-like modifier 3.1 (SUMO3.1) mRNA, complete cds.

KC246589; SV 1; linear; mRNA; STD; PLN; 306 BP.
KC246589;
Brassica napus small ubiquitin-like modifier 5.1 (SUMO5.1) mRNA, complete cds.

KC246590; SV 1; linear; mRNA; STD; PLN; 306 BP.
KC246590;
Brassica napus small ubiquitin-like modifier 5.2 (SUMO5.2) mRNA, complete cds.

KC246591; SV 1; linear; mRNA; STD; PLN; 1754 BP.
KC246591;
Brassica napus mitogen activated kinase kinase kinase ZIK3.2 (ZIK3.2) mRNA, partial cds.

KC246592; SV 1; linear; mRNA; STD; PLN; 1713 BP.
KC246592;
Brassica napus mitogen activated kinase kinase kinase Raf30.2 (Raf30.2) mRNA, complete cds.

KC246593; SV 1; linear; mRNA; STD; PLN; 1029 BP.
KC246593;
Brassica napus mitogen activated kinase kinase kinase 18.2 (MAPKKK18.2) mRNA, complete cds.

KC246594; SV 1; linear; mRNA; STD; PLN; 1311 BP.
KC246594;
Brassica napus mitogen-activated protein kinase kinase kinase Raf17.2 (Raf17.2) mRNA, complete cds.

KC342233; SV 1; linear; mRNA; STD; PLN; 3519 BP.
KC342233;
Brassica rapa phytochrome B mRNA, complete cds.

KC896403; SV 2; linear; mRNA; STD; PLN; 1320 BP.
KC896403;
Brassica oleracea var. viridis AP3a mRNA, complete cds.

KC967962; SV 2; linear; mRNA; STD; PLN; 951 BP.
KC967962;
Brassica oleracea var. viridis PI.b (PI.b) mRNA, complete cds.

KF030503; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030503;
Brassica oleracea isolate 1-A fatty acid elongase 1 (FAE1) gene, partial cds.

KF030504; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030504;
Brassica oleracea var. botrytis isolate 1-B fatty acid elongase 1 (FAE1) gene, partial cds.

KF030505; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030505;
Brassica oleracea var. italica isolate 1-C fatty acid elongase 1 (FAE1) gene, partial cds.

KF030506; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030506;
Brassica oleracea var. gemmifera isolate 1-D fatty acid elongase 1 (FAE1) gene, partial cds.

KF030507; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030507;
Brassica oleracea var. gongylodes isolate 1-E fatty acid elongase 1 (FAE1) gene, partial cds.

KF030508; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030508;
Brassica oleracea var. albiflora isolate 1-F fatty acid elongase 1 (FAE1) gene, partial cds.

KF030509; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030509;
Brassica rapa isolate 1-G fatty acid elongase 1 (FAE1) gene, partial cds.

KF030512; SV 1; linear; genomic DNA; STD; PLN; 892 BP.
KF030512;
Brassica napus subsp. rapifera isolate 1-K fatty acid elongase 1 (FAE1) gene, partial cds.

KF704394; SV 1; linear; genomic DNA; STD; PLN; 690 BP.
KF704394;
Brassica rapa 18S ribosomal RNA gene, partial sequence; internal transcribed spacer 1, 5.8S ribosomal RNA gene, and internal transcribed spacer 2, complete sequence; and 28S ribosomal RNA gene, partial sequence.

KF724897; SV 1; linear; genomic DNA; STD; PLN; 3350 BP.
KF724897;
Brassica napus CER1 gene, complete cds.

KF724898; SV 1; linear; genomic DNA; STD; PLN; 3351 BP.
KF724898;
Brassica napus nonfunctional CER1 gene, complete sequence.


[2015|2013]