03/03/2015

KP100641; SV 1; linear; mRNA; STD; PLN; 2039 BP.
KP100641;
Brassica napus glycosyltransferase mRNA, complete cds.

KP658825; SV 1; linear; genomic DNA; STD; PLN; 1791 BP.
KP658825;
Brassica oleracea var. alboglabra carotenoid cleavage dioxygenase 4 (CCD4) gene, CCD4-WT allele, complete cds.

KP658826; SV 1; linear; genomic DNA; STD; PLN; 9360 BP.
KP658826;
Brassica napus nonfunctional carotenoid cleavage dioxygenase 4 (CCD4) gene, CCD4-M1 allele and transposon CACTA-like, complete sequence.

KP658827; SV 1; linear; genomic DNA; STD; PLN; 1791 BP.
KP658827;
Brassica oleracea var. viridis truncated carotenoid cleavage dioxygenase 4 (CCD4) gene, CCD4-M2 allele, complete cds.

KP658828; SV 1; linear; genomic DNA; STD; PLN; 1783 BP.
KP658828;
Brassica oleracea var. botrytis truncated carotenoid cleavage dioxygenase 4 (CCD4) gene, CCD4-M3 allele, complete cds.

KP658829; SV 1; linear; genomic DNA; STD; PLN; 3478 BP.
KP658829;
Brassica oleracea var. capitata nonfunctional carotenoid cleavage dioxygenase 4 (CCD4) gene, CCD4-M4 allele and transposon CACTA-like, complete sequence.


28/02/2015

KM111290; SV 1; linear; mRNA; STD; PLN; 1509 BP.
KM111290;
Brassica oleracea var. italica cytochrome P450 CYP83A1 mRNA, complete cds.


21/02/2015

KJ684989; SV 1; linear; genomic DNA; STD; PLN; 214 BP.
KJ684989;
Brassica oleracea isolate Brole_1284 trnS-trnG intergenic spacer, partial sequence; chloroplast.

KJ685073; SV 1; linear; genomic DNA; STD; PLN; 349 BP.
KJ685073;
Brassica oleracea isolate Brole_1284 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KJ685116; SV 1; linear; genomic DNA; STD; PLN; 251 BP.
KJ685116;
Brassica oleracea isolate Brole_1284 trnH-psbA intergenic spacer, partial sequence; chloroplast.


14/02/2015

KM593132; SV 1; linear; mRNA; STD; PLN; 1565 BP.
KM593132;
Brassica oleracea var. capitata WRKY transcription factor (WRKY7) mRNA, complete cds.

KM593133; SV 1; linear; mRNA; STD; PLN; 1960 BP.
KM593133;
Brassica oleracea var. capitata WRKY transcription factor (WRKY9) mRNA, complete cds.

KM593134; SV 1; linear; mRNA; STD; PLN; 1524 BP.
KM593134;
Brassica oleracea var. capitata WRKY transcription factor (WRKY14) mRNA, complete cds.

KM593135; SV 1; linear; mRNA; STD; PLN; 1846 BP.
KM593135;
Brassica oleracea var. capitata WRKY transcription factor (WRKY17) mRNA, complete cds.

KM593136; SV 1; linear; mRNA; STD; PLN; 2013 BP.
KM593136;
Brassica oleracea var. capitata WRKY transcription factor (WRKY20) mRNA, complete cds.

KM593137; SV 1; linear; mRNA; STD; PLN; 1802 BP.
KM593137;
Brassica oleracea var. capitata WRKY transcription factor (WRKY22) mRNA, complete cds.

KM593138; SV 1; linear; mRNA; STD; PLN; 1622 BP.
KM593138;
Brassica oleracea var. capitata WRKY transcription factor (WRKY28) mRNA, complete cds.

KM593139; SV 1; linear; mRNA; STD; PLN; 1939 BP.
KM593139;
Brassica oleracea var. capitata WRKY transcription factor (WRKY29) mRNA, complete cds.

KM593140; SV 1; linear; mRNA; STD; PLN; 1237 BP.
KM593140;
Brassica oleracea var. capitata WRKY transcription factor (WRKY32) mRNA, complete cds.

KM593141; SV 1; linear; mRNA; STD; PLN; 804 BP.
KM593141;
Brassica oleracea var. capitata WRKY transcription factor (WRKY33) mRNA, partial cds.

KM593142; SV 1; linear; mRNA; STD; PLN; 1593 BP.
KM593142;
Brassica oleracea var. capitata WRKY transcription factor (WRKY35) mRNA, complete cds.

KM593143; SV 1; linear; mRNA; STD; PLN; 985 BP.
KM593143;
Brassica oleracea var. capitata WRKY transcription factor (WRKY40) mRNA, complete cds.

KM593144; SV 1; linear; mRNA; STD; PLN; 1422 BP.
KM593144;
Brassica oleracea var. capitata WRKY transcription factor (WRKY41) mRNA, complete cds.

KM593145; SV 1; linear; mRNA; STD; PLN; 1773 BP.
KM593145;
Brassica oleracea var. capitata WRKY transcription factor (WRKY45) mRNA, complete cds.

KM593146; SV 1; linear; mRNA; STD; PLN; 1419 BP.
KM593146;
Brassica oleracea var. capitata WRKY transcription factor (WRKY51) mRNA, complete cds.

KM593147; SV 1; linear; mRNA; STD; PLN; 1605 BP.
KM593147;
Brassica oleracea var. capitata WRKY transcription factor (WRKY53) mRNA, complete cds.

KM593148; SV 1; linear; mRNA; STD; PLN; 1672 BP.
KM593148;
Brassica oleracea var. capitata WRKY transcription factor (WRKY54) mRNA, complete cds.

KM593149; SV 1; linear; mRNA; STD; PLN; 775 BP.
KM593149;
Brassica oleracea var. capitata WRKY transcription factor (WRKY57) mRNA, complete cds.

KM593150; SV 1; linear; mRNA; STD; PLN; 2025 BP.
KM593150;
Brassica oleracea var. capitata WRKY transcription factor (WRKY58) mRNA, complete cds.

KM593151; SV 1; linear; mRNA; STD; PLN; 1422 BP.
KM593151;
Brassica oleracea var. capitata WRKY transcription factor (WRKY65) mRNA, complete cds.

KM593152; SV 1; linear; mRNA; STD; PLN; 1008 BP.
KM593152;
Brassica oleracea var. capitata WRKY transcription factor (WRKY70) mRNA, complete cds.

KM593153; SV 1; linear; mRNA; STD; PLN; 2064 BP.
KM593153;
Brassica oleracea var. capitata WRKY transcription factor (WRKY72) mRNA, complete cds.

KM593154; SV 1; linear; mRNA; STD; PLN; 1435 BP.
KM593154;
Brassica oleracea var. capitata WRKY transcription factor (WRKY79) mRNA, complete cds. FT                   FSWRKYGQKPIKGSPHPRGYYKCSSMRGCPARKHVERAPDDAMMLIVTYEGDHNHAMVL

KM593155; SV 1; linear; mRNA; STD; PLN; 1830 BP.
KM593155;
Brassica oleracea var. capitata WRKY transcription factor (WRKY81) mRNA, complete cds.

KM593156; SV 1; linear; mRNA; STD; PLN; 2065 BP.
KM593156;
Brassica oleracea var. capitata WRKY transcription factor (WRKY82) mRNA, complete cds.

KM593157; SV 1; linear; mRNA; STD; PLN; 1084 BP.
KM593157;
Brassica oleracea var. capitata WRKY transcription factor (WRKY84) mRNA, complete cds.

KM593158; SV 1; linear; mRNA; STD; PLN; 955 BP.
KM593158;
Brassica oleracea var. capitata WRKY transcription factor (WRKY85) mRNA, complete cds.

KM593159; SV 1; linear; mRNA; STD; PLN; 2114 BP.
KM593159;
Brassica oleracea var. capitata WRKY transcription factor (WRKY87) mRNA, complete cds.

KM593160; SV 1; linear; mRNA; STD; PLN; 583 BP.
KM593160;
Brassica oleracea var. capitata WRKY transcription factor (WRKY92) mRNA, partial cds.

KM593161; SV 1; linear; mRNA; STD; PLN; 1855 BP.
KM593161;
Brassica oleracea var. capitata WRKY transcription factor (WRKY94) mRNA, complete cds.

KM593162; SV 1; linear; mRNA; STD; PLN; 545 BP.
KM593162;
Brassica oleracea var. capitata WRKY transcription factor (WRKY106) mRNA, complete cds.

KM593163; SV 1; linear; mRNA; STD; PLN; 938 BP.
KM593163;
Brassica oleracea var. capitata WRKY transcription factor (WRKY115) mRNA, complete cds.

KM593164; SV 1; linear; mRNA; STD; PLN; 569 BP.
KM593164;
Brassica oleracea var. capitata WRKY transcription factor (WRKY121) mRNA, partial cds.

KM593165; SV 1; linear; mRNA; STD; PLN; 1273 BP.
KM593165;
Brassica oleracea var. capitata WRKY transcription factor (WRKY139) mRNA, partial cds.

KM593166; SV 1; linear; mRNA; STD; PLN; 1652 BP.
KM593166;
Brassica oleracea var. capitata WRKY transcription factor (WRKY140) mRNA, complete cds.

KM593167; SV 1; linear; mRNA; STD; PLN; 2628 BP.
KM593167;
Brassica oleracea var. capitata WRKY transcription factor (WRKY141) mRNA, complete cds.

KM593168; SV 1; linear; mRNA; STD; PLN; 1240 BP.
KM593168;
Brassica oleracea var. capitata WRKY transcription factor (WRKY146) mRNA, complete cds.


13/02/2015

KF974755; SV 1; linear; mRNA; STD; PLN; 1095 BP.
KF974755;
Brassica napus NAC transcription factor 12-1 (NAC12-1.1) mRNA, complete cds.

KF974756; SV 1; linear; mRNA; STD; PLN; 1530 BP.
KF974756;
Brassica napus NAC transcription factor 13-1 (NAC13-1.1) mRNA, complete cds.

KF974757; SV 1; linear; mRNA; STD; PLN; 1132 BP.
KF974757;
Brassica napus NAC transcription factor 18-1 (NAC18-1.1) mRNA, complete cds.

KF974758; SV 1; linear; mRNA; STD; PLN; 1129 BP.
KF974758;
Brassica napus NAC transcription factor 18-2 (NAC18-2.1) mRNA, complete cds.

KF974759; SV 1; linear; mRNA; STD; PLN; 1124 BP.
KF974759;
Brassica napus NAC transcription factor 25-1 (NAC25-1.1) mRNA, complete cds.

KF974760; SV 1; linear; mRNA; STD; PLN; 1120 BP.
KF974760;
Brassica napus NAC transcription factor 47-1 (NAC47-1.1) mRNA, complete cds.

KF974761; SV 1; linear; mRNA; STD; PLN; 1208 BP.
KF974761;
Brassica napus NAC transcription factor 56-1 (NAC56-1.1) mRNA, complete cds.

KF974762; SV 1; linear; mRNA; STD; PLN; 1236 BP.
KF974762;
Brassica napus NAC transcription factor 56-2 (NAC56-2.1) mRNA, complete cds.

KF974763; SV 1; linear; mRNA; STD; PLN; 1023 BP.
KF974763;
Brassica napus NAC transcription factor 60-1 (NAC60-1.1) mRNA, complete cds.

KF974764; SV 1; linear; mRNA; STD; PLN; 1032 BP.
KF974764;
Brassica napus NAC transcription factor 89-1 (NAC89-1.1) mRNA, complete cds.

KF974765; SV 1; linear; mRNA; STD; PLN; 555 BP.
KF974765;
Brassica napus NAC transcription factor 97-1 (NAC97-1.1) mRNA, complete cds.

KF974766; SV 1; linear; mRNA; STD; PLN; 1096 BP.
KF974766;
Brassica napus NAC transcription factor 102-1 (NAC102-1.1) mRNA, complete cds.

KJ670121; SV 1; linear; mRNA; STD; PLN; 1002 BP.
KJ670121;
Brassica napus NAC transcription factor 55-1 (NAC55-1.1) mRNA, complete cds.

KJ670122; SV 1; linear; mRNA; STD; PLN; 795 BP.
KJ670122;
Brassica napus NAC transcription factor 102-2 (NAC102-2.1) mRNA, complete cds.

KJ670123; SV 1; linear; mRNA; STD; PLN; 1002 BP.
KJ670123;
Brassica napus NAC transcription factor 55-2 (NAC55-2.1) mRNA, complete cds.

KJ670124; SV 1; linear; mRNA; STD; PLN; 795 BP.
KJ670124;
Brassica napus NAC transcription factor 102-3 (NAC102-3.1) mRNA, complete cds.


12/02/2015

KM975572; SV 1; linear; genomic DNA; STD; PLN; 540 BP.
KM975572;
Brassica napus clone Pactol internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975573; SV 1; linear; genomic DNA; STD; PLN; 587 BP.
KM975573;
Brassica napus clone serw-4 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975574; SV 1; linear; genomic DNA; STD; PLN; 579 BP.
KM975574;
Brassica napus clone 31/09 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975575; SV 1; linear; genomic DNA; STD; PLN; 612 BP.
KM975575;
Brassica napus clone 27/09 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975576; SV 1; linear; genomic DNA; STD; PLN; 574 BP.
KM975576;
Brassica napus clone sedo internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975577; SV 1; linear; genomic DNA; STD; PLN; 593 BP.
KM975577;
Brassica napus clone 14/09 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975578; SV 1; linear; genomic DNA; STD; PLN; 598 BP.
KM975578;
Brassica napus clone Global internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975579; SV 1; linear; genomic DNA; STD; PLN; 559 BP.
KM975579;
Brassica napus clone 5/09 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975580; SV 1; linear; genomic DNA; STD; PLN; 618 BP.
KM975580;
Brassica napus clone 20/09 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.

KM975581; SV 1; linear; genomic DNA; STD; PLN; 579 BP.
KM975581;
Brassica napus clone 10/09 internal transcribed spacer 1, partial sequence; 5.8S ribosomal RNA gene, complete sequence; and internal transcribed spacer 2, partial sequence.


11/02/2015

HG323751; SV 1; linear; transcribed RNA; STD; PLN; 308 BP.
HG323751;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323752; SV 1; linear; transcribed RNA; STD; PLN; 308 BP.
HG323752;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323753; SV 1; linear; transcribed RNA; STD; PLN; 308 BP.
HG323753;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323754; SV 1; linear; transcribed RNA; STD; PLN; 308 BP.
HG323754;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323755; SV 1; linear; transcribed RNA; STD; PLN; 308 BP.
HG323755;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323756; SV 1; linear; transcribed RNA; STD; PLN; 309 BP.
HG323756;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323757; SV 1; linear; transcribed RNA; STD; PLN; 306 BP.
HG323757;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323758; SV 1; linear; transcribed RNA; STD; PLN; 308 BP.
HG323758;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323759; SV 1; linear; transcribed RNA; STD; PLN; 308 BP.
HG323759;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

HG323760; SV 1; linear; transcribed RNA; STD; PLN; 309 BP.
HG323760;
TPA: Brassica napus SRP RNA for signal recognition particle RNA

KM097068; SV 1; linear; genomic DNA; STD; PLN; 4488 BP.
KM097068;
Brassica napus cultivar Glacier RLM2 (Rlm2) gene, complete cds.

KM097069; SV 1; linear; genomic DNA; STD; PLN; 4488 BP.
KM097069;
Brassica napus cultivar Tapidor DH RLM2 (Rlm2) gene, complete cds.

KM097070; SV 1; linear; genomic DNA; STD; PLN; 4489 BP.
KM097070;
Brassica napus cultivar Bristol RLM2 (Rlm2) gene, complete cds.

KM097071; SV 1; linear; genomic DNA; STD; PLN; 4235 BP.
KM097071;
Brassica napus cultivar Hyola 60 LEPR3 (LepR3) gene, complete cds.

KM097072; SV 1; linear; genomic DNA; STD; PLN; 5600 BP.
KM097072;
Brassica napus cultivar Columbus LEPR3 (LepR3) gene, complete cds.

KM097073; SV 1; linear; genomic DNA; STD; PLN; 5600 BP.
KM097073;
Brassica napus cultivar Westar N-o-1 LEPR3 (LepR3) gene, complete cds.

KM097074; SV 1; linear; genomic DNA; STD; PLN; 5602 BP.
KM097074;
Brassica napus cultivar Polo LEPR3 (LepR3) gene, complete cds.

KM097075; SV 1; linear; genomic DNA; STD; PLN; 5783 BP.
KM097075;
Brassica napus cultivar Ning You LEPR3 (LepR3) gene, complete cds.

KM097076; SV 1; linear; genomic DNA; STD; PLN; 5601 BP.
KM097076;
Brassica napus cultivar Hvammsrofa LEPR3 (LepR3) gene, complete cds.

KM097077; SV 1; linear; genomic DNA; STD; PLN; 4462 BP.
KM097077;
Brassica rapa cultivar Torch LEPR3 (LepR3) gene, LepR3-2 allele, complete cds.

KM097078; SV 1; linear; genomic DNA; STD; PLN; 4429 BP.
KM097078;
Brassica rapa cultivar 006-1-1 LEPR3 (lepR3) gene, lepR3-3 allele, complete cds.

KM097079; SV 1; linear; genomic DNA; STD; PLN; 3962 BP.
KM097079;
Brassica napus cultivar Marnoo LEPR3 (LepR3) gene, LepR3-4 allele, complete cds.

KM097081; SV 1; linear; genomic DNA; STD; PLN; 5605 BP.
KM097081;
Brassica napus cultivar Quantum LEPR3 (LepR3) gene, complete cds.


10/02/2015

KM975667; SV 1; linear; mRNA; STD; PLN; 1155 BP.
KM975667;
Brassica napus NAC transcription factor 7.1 (NAC7.1) mRNA, complete cds.

KM975668; SV 1; linear; mRNA; STD; PLN; 759 BP.
KM975668;
Brassica napus NAC transcription factor 41.1 (NAC41.1) mRNA, complete cds.

KM975669; SV 1; linear; mRNA; STD; PLN; 840 BP.
KM975669;
Brassica napus NAC transcription factor 42.1 (NAC42.1) mRNA, complete cds.


09/02/2015

KM881429; SV 1; linear; mRNA; STD; PLN; 1134 BP.
KM881429;
Brassica napus actin mRNA, complete cds.


02/02/2015

AB495254; SV 1; linear; genomic DNA; STS; PLN; 42 BP.
AB495254;
Brassica rapa DNA, cloned AFLP fragment, clone: E2M2-61.2-8, sequence tagged site.

AB495255; SV 1; linear; genomic DNA; STS; PLN; 214 BP.
AB495255;
Brassica rapa DNA, cloned AFLP fragment, clone: E2M5-238.2-2, sequence tagged site.

AB495256; SV 1; linear; genomic DNA; STS; PLN; 85 BP.
AB495256;
Brassica rapa DNA, cloned AFLP fragment, clone: E3M8-108-1, sequence tagged site.

AB495257; SV 1; linear; genomic DNA; STS; PLN; 272 BP.
AB495257;
Brassica rapa DNA, cloned AFLP fragment, clone: E4M4-294-1, sequence tagged site.

AB495258; SV 1; linear; genomic DNA; STS; PLN; 283 BP.
AB495258;
Brassica rapa DNA, cloned AFLP fragment, clone: E4M6-308.1-12, sequence tagged site.

AB495259; SV 1; linear; genomic DNA; STS; PLN; 284 BP.
AB495259;
Brassica rapa DNA, cloned AFLP fragment, clone: E4M6-309-9, sequence tagged site.

AB495260; SV 1; linear; genomic DNA; STS; PLN; 105 BP.
AB495260;
Brassica rapa DNA, cloned AFLP fragment, clone: E5M5-127-16, sequence tagged site.

KF297329; SV 1; linear; mRNA; STD; PLN; 1251 BP.
KF297329;
Brassica napus isolate BnaC.PSY.f phytoene synthase mRNA, complete cds.

KF297330; SV 1; linear; mRNA; STD; PLN; 1742 BP.
KF297330;
Brassica napus isolate BnaA.PSY.b phytoene synthase mRNA, complete cds.

KF297331; SV 1; linear; mRNA; STD; PLN; 1740 BP.
KF297331;
Brassica napus isolate BnaA.PSY.c phytoene synthase mRNA, complete cds.

KF297332; SV 1; linear; mRNA; STD; PLN; 1692 BP.
KF297332;
Brassica napus isolate BnaA.PSY.d phytoene synthase mRNA, complete cds.

KF297333; SV 1; linear; mRNA; STD; PLN; 1769 BP.
KF297333;
Brassica napus isolate BnaC.PSY.a phytoene synthase mRNA, complete cds.

KF297334; SV 1; linear; mRNA; STD; PLN; 1512 BP.
KF297334;
Brassica napus isolate BnaC.PSY.e phytoene synthase mRNA, complete cds.


01/02/2015

AB495254; SV 1; linear; genomic DNA; STS; PLN; 42 BP.
AB495254;
Brassica rapa DNA, cloned AFLP fragment, clone: E2M2-61.2-8, sequence tagged site.

AB495255; SV 1; linear; genomic DNA; STS; PLN; 214 BP.
AB495255;
Brassica rapa DNA, cloned AFLP fragment, clone: E2M5-238.2-2, sequence tagged site.

AB495256; SV 1; linear; genomic DNA; STS; PLN; 85 BP.
AB495256;
Brassica rapa DNA, cloned AFLP fragment, clone: E3M8-108-1, sequence tagged site.

AB495257; SV 1; linear; genomic DNA; STS; PLN; 272 BP.
AB495257;
Brassica rapa DNA, cloned AFLP fragment, clone: E4M4-294-1, sequence tagged site.

AB495258; SV 1; linear; genomic DNA; STS; PLN; 283 BP.
AB495258;
Brassica rapa DNA, cloned AFLP fragment, clone: E4M6-308.1-12, sequence tagged site.

AB495259; SV 1; linear; genomic DNA; STS; PLN; 284 BP.
AB495259;
Brassica rapa DNA, cloned AFLP fragment, clone: E4M6-309-9, sequence tagged site.

AB495260; SV 1; linear; genomic DNA; STS; PLN; 105 BP.
AB495260;
Brassica rapa DNA, cloned AFLP fragment, clone: E5M5-127-16, sequence tagged site.

KM816807; SV 1; linear; genomic DNA; STD; PLN; 1968 BP.
KM816807;
Brassica napus cultivar SH11 SH11 acetohydroxyacid synthase (ALS1) gene, complete cds. FT                   LTEGKAIISTGVGQHQMWAAQFYKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIV

KM816808; SV 1; linear; genomic DNA; STD; PLN; 1914 BP.
KM816808;
Brassica napus cultivar SH11 SH11 acetohydroxyacid synthase (ALS2) gene, complete cds.

KM816809; SV 1; linear; genomic DNA; STD; PLN; 1959 BP.
KM816809;
Brassica napus cultivar SH11 SH11 acetohydroxyacid synthase (ALS3) gene, complete cds.

KM816810; SV 1; linear; genomic DNA; STD; PLN; 1968 BP.
KM816810;
Brassica napus cultivar Zhongshuang No.9 acetolactate synthetase (ALS1) gene, complete cds. FT                   LTEGKAIISTGVGQHQMWAAQFYKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIV

KM816811; SV 1; linear; genomic DNA; STD; PLN; 1914 BP.
KM816811;
Brassica napus cultivar Zhongshuang No.9 acetolactate synthetase (ALS2) gene, complete cds.

KM816812; SV 1; linear; genomic DNA; STD; PLN; 1959 BP.
KM816812;
Brassica napus cultivar Zhongshuang No.9 acetolactate synthetase (ALS3) gene, complete cds.

KM816813; SV 1; linear; genomic DNA; STD; PLN; 1968 BP.
KM816813;
Brassica napus cultivar Qinyou No.3 acetolactate synthetase (ALS1) gene, complete cds. FT                   LTEGKAIISTGVGQHQMWAAQFYKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIV

KM816814; SV 1; linear; genomic DNA; STD; PLN; 1914 BP.
KM816814;
Brassica napus cultivar Qinyou No.3 acetolactate synthetase (ALS2) gene, complete cds.

KM816815; SV 1; linear; genomic DNA; STD; PLN; 1959 BP.
KM816815;
Brassica napus cultivar Qinyou No.3 acetolactate synthetase (ALS3) gene, complete cds.

KM816816; SV 1; linear; genomic DNA; STD; PLN; 1968 BP.
KM816816;
Brassica napus acetolactate synthetase (ALS1) gene, complete cds. FT                   LTEGKAIISTGVGQHQMWAAQFYKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIV

KM816817; SV 1; linear; genomic DNA; STD; PLN; 1914 BP.
KM816817;
Brassica napus acetolactate synthetase (ALS2) gene, complete cds.

KM816818; SV 1; linear; genomic DNA; STD; PLN; 1959 BP.
KM816818;
Brassica napus acetolactate synthetase (ALS3) gene, complete cds.

KM816819; SV 1; linear; genomic DNA; STD; PLN; 1968 BP.
KM816819;
Brassica oleracea cultivar Texuan zhonggan No.11 acetolactate synthetase (ALS1) gene, complete cds. FT                   LTEGKAIISTGVGQHQMWAAQFYKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIV

KM816820; SV 1; linear; genomic DNA; STD; PLN; 1968 BP.
KM816820;
Brassica oleracea cultivar Wanfeng acetolactate synthetase (ALS1) gene, complete cds. FT                   LTEGKAIISTGVGQHQMWAAQFYKYRKPRQWLSSSGLGAMGFGLPAAIGASVANPDAIV

KM816827; SV 1; linear; genomic DNA; STD; PLN; 1914 BP.
KM816827;
Brassica rapa cultivar Jinqiu 66 acetolactate synthetase (ALS2) gene, complete cds.

KM816828; SV 1; linear; genomic DNA; STD; PLN; 1959 BP.
KM816828;
Brassica rapa cultivar Jinqiu 66 acetolactate synthetase (ALS3) gene, complete cds.

KM816829; SV 1; linear; genomic DNA; STD; PLN; 1914 BP.
KM816829;
Brassica rapa cultivar Binxianyimenyoucai acetolactate synthetase (ALS2) gene, complete cds.

KM816830; SV 1; linear; genomic DNA; STD; PLN; 1959 BP.
KM816830;
Brassica rapa cultivar Binxianyimenyoucai acetolactate synthetase (ALS3) gene, complete cds.

KM816831; SV 1; linear; genomic DNA; STD; PLN; 1914 BP.
KM816831;
Brassica rapa cultivar Opava acetolactate synthetase (ALS2) gene, complete cds.

KM816832; SV 1; linear; genomic DNA; STD; PLN; 1959 BP.
KM816832;
Brassica rapa cultivar Opava acetolactate synthetase (ALS3) gene, complete cds.

KM816833; SV 1; linear; genomic DNA; STD; PLN; 1914 BP.
KM816833;
Brassica rapa cultivar Rapido acetolactate synthetase (ALS2) gene, complete cds.

KM816834; SV 1; linear; genomic DNA; STD; PLN; 1959 BP.
KM816834;
Brassica rapa cultivar Rapido acetolactate synthetase (ALS3) gene, complete cds.

KM875557; SV 1; linear; genomic DNA; STD; PLN; 1945 BP.
KM875557;
Brassica napus cultivar Topas O-fucosyltransferase family protein gene, complete cds.

KP295464; SV 1; linear; mRNA; STD; PLN; 1394 BP.
KP295464;
Brassica oleracea var. alboglabra BCAT4 (BCAT4) mRNA, complete cds.

KP295465; SV 1; linear; mRNA; STD; PLN; 1560 BP.
KP295465;
Brassica oleracea var. alboglabra MAM1 (MAM1) mRNA, complete cds.

KP295466; SV 1; linear; mRNA; STD; PLN; 1685 BP.
KP295466;
Brassica oleracea var. alboglabra CYP79F1 (CYP79F1) mRNA, complete cds.

L25398; SV 1; linear; genomic DNA; STD; PLN; 330 BP.
L25398;
Brassica campestris cyclin gene, partial cds.

L48178; SV 1; linear; mRNA; STD; PLN; 1913 BP.
L48178;
Brassica rapa subsp. pekinensis pectinesterase mRNA, partial cds.


28/01/2015

AB981181; SV 1; linear; genomic DNA; STD; PLN; 6286 BP.
AB981181;
Brassica oleracea var. capitata FocBo1 gene, complete cds, cultivar: AnjuP01.

AB981182; SV 1; linear; mRNA; STD; PLN; 4420 BP.
AB981182;
Brassica oleracea var. capitata FocBo1 mRNA, complete cds, cultivar: AnjuP01.


22/01/2015

KM373223; SV 1; linear; genomic DNA; STD; PLN; 1144 BP.
KM373223;
Brassica napus DOG1-like protein (BnaA.DOG1.a) gene, complete cds. FT                   EEKMTKKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLR

KM373224; SV 1; linear; genomic DNA; STD; PLN; 1148 BP.
KM373224;
Brassica napus DOG1-like protein (BnaC.DOG1.a) gene, complete cds. FT                   EEKMTKKVSSLQEDAADIPISTVAYAEEHVGEPNLAVDQALDKQEEAMATLLAEADNLR

KM373225; SV 1; linear; genomic DNA; STD; PLN; 1432 BP.
KM373225;
Brassica napus DOG1-like protein (BnaC.DOG1.b) gene, complete cds. FT                   EEKMTKKVSSLQEDAADIPISTVAYAEEHVGEPNAMVDQALDKQEEAMATLLAEADNLR


19/01/2015

KM284681; SV 1; linear; genomic DNA; STD; PLN; 2347 BP.
KM284681;
Brassica napus clone BnaProDH1_Sc574.1 proline dehydrogenase gene, complete cds.

KM284682; SV 1; linear; genomic DNA; STD; PLN; 2292 BP.
KM284682;
Brassica napus clone BnaProDH1_Sc11880.1 proline dehydrogenase gene, complete cds.

KM284683; SV 1; linear; genomic DNA; STD; PLN; 2232 BP.
KM284683;
Brassica napus clone BnaProDH1_Sc55.1 proline dehydrogenase gene, complete cds.

KM284684; SV 1; linear; genomic DNA; STD; PLN; 2225 BP.
KM284684;
Brassica napus clone BnaProDH1_Sc9226.1 proline dehydrogenase gene, complete cds.

KM284685; SV 1; linear; genomic DNA; STD; PLN; 2446 BP.
KM284685;
Brassica napus clone BnaProDH1_Sc9244.1 proline dehydrogenase gene, complete cds.

KM284686; SV 1; linear; genomic DNA; STD; PLN; 2671 BP.
KM284686;
Brassica napus clone BnaProDH2_Sc14556_Sc15_Sc142.1 proline dehydrogenase gene, complete cds.

KM284687; SV 1; linear; genomic DNA; STD; PLN; 2719 BP.
KM284687;
Brassica napus clone BnaProDH2_Sc142.1 proline dehydrogenase gene, complete cds.

KM284688; SV 1; linear; genomic DNA; STD; PLN; 2766 BP.
KM284688;
Brassica napus clone BnaProDH1_Sc855.1 proline dehydrogenase gene, complete cds.


14/01/2015

KJ596447; SV 1; linear; genomic DNA; STD; PLN; 3172 BP.
KJ596447;
Brassica napus WRKY44 (A.TTG2.a) gene, complete cds.

KJ596448; SV 1; linear; genomic DNA; STD; PLN; 3142 BP.
KJ596448;
Brassica napus WRKY44 (A.TTG2.b) gene, complete cds.

KJ596449; SV 1; linear; genomic DNA; STD; PLN; 3395 BP.
KJ596449;
Brassica napus WRKY44 (C.TTG2.a) gene, complete cds.

KJ596450; SV 1; linear; genomic DNA; STD; PLN; 3150 BP.
KJ596450;
Brassica napus WRKY44 (C.TTG2.b) gene, complete cds.


03/01/2015

KC787673; SV 1; linear; genomic DNA; STD; PLN; 1060 BP.
KC787673;
Brassica napus transcription factor subunit NF-YB11A (NF-YB11A) gene, complete cds.

KC787674; SV 1; linear; genomic DNA; STD; PLN; 1058 BP.
KC787674;
Brassica napus transcription factor subunit NF-YB11B (NF-YB11B) gene, complete cds.

KC787675; SV 1; linear; genomic DNA; STD; PLN; 1144 BP.
KC787675;
Brassica napus transcription factor subunit NF-YB12 (NF-YB12) gene, complete cds.

KC787676; SV 1; linear; genomic DNA; STD; PLN; 1351 BP.
KC787676;
Brassica napus transcription factor subunit NF-YB13 (NF-YB13) gene, complete cds.

KC797140; SV 1; linear; genomic DNA; STD; PLN; 595 BP.
KC797140;
Brassica napus transcription factor subunit NF-YC13 (NF-YC13) gene, complete cds.

KC797146; SV 1; linear; genomic DNA; STD; PLN; 943 BP.
KC797146;
Brassica napus transcription factor subunit NF-YC10A (NF-YC10A) gene, complete cds.

KC797147; SV 1; linear; genomic DNA; STD; PLN; 1500 BP.
KC797147;
Brassica napus transcription factor subunit NF-YC10B (NF-YC10B) gene, complete cds.

KC797148; SV 1; linear; genomic DNA; STD; PLN; 1448 BP.
KC797148;
Brassica napus transcription factor subunit NF-YC10C (NF-YC10C) gene, complete cds.

KC797149; SV 1; linear; genomic DNA; STD; PLN; 2197 BP.
KC797149;
Brassica napus transcription factor subunit NF-YC11B (NF-YC11B) gene, complete cds.

KC818622; SV 1; linear; genomic DNA; STD; PLN; 1854 BP.
KC818622;
Brassica napus transcription factor subunit NF-YC11A (NF-YC11A) gene, complete cds.


02/01/2015

KC966733; SV 1; linear; mRNA; STD; PLN; 1193 BP.
KC966733;
Brassica napus MYB transcription factor 106 (MYB106.1) mRNA, complete cds.

KC966734; SV 1; linear; mRNA; STD; PLN; 1195 BP.
KC966734;
Brassica napus MYB transcription factor 16 (MYB16.1) mRNA, complete cds.

KC966735; SV 1; linear; mRNA; STD; PLN; 1195 BP.
KC966735;
Brassica napus MYB transcription factor 30 (MYB30.1) mRNA, complete cds.

KC966736; SV 1; linear; mRNA; STD; PLN; 993 BP.
KC966736;
Brassica napus MYB transcription factor 3 (MYB3.1) mRNA, complete cds.

KC966737; SV 1; linear; mRNA; STD; PLN; 1088 BP.
KC966737;
Brassica napus MYB transcription factor 44 (MYB44.1) mRNA, complete cds.

KC966738; SV 1; linear; mRNA; STD; PLN; 790 BP.
KC966738;
Brassica napus MYB transcription factor 48 (MYB48.1) mRNA, partial cds.

KC966739; SV 1; linear; mRNA; STD; PLN; 1125 BP.
KC966739;
Brassica napus MYB transcription factor 56 (MYB56.1) mRNA, complete cds.

KC966740; SV 1; linear; mRNA; STD; PLN; 789 BP.
KC966740;
Brassica napus MYB transcription factor 59 (MYB59.1) mRNA, partial cds.

KC966741; SV 1; linear; mRNA; STD; PLN; 1144 BP.
KC966741;
Brassica napus MYB transcription factor 61 (MYB61.1) mRNA, complete cds.

KC966742; SV 1; linear; mRNA; STD; PLN; 1165 BP.
KC966742;
Brassica napus MYB transcription factor 73 (MYB73.1) mRNA, complete cds.

KC966743; SV 1; linear; mRNA; STD; PLN; 1153 BP.
KC966743;
Brassica napus MYB transcription factor 77 (MYB77.1) mRNA, complete cds.

KC966744; SV 1; linear; mRNA; STD; PLN; 1255 BP.
KC966744;
Brassica napus MYB transcription factor 12 (MYB12.1) mRNA, complete cds.

KC966745; SV 1; linear; mRNA; STD; PLN; 1156 BP.
KC966745;
Brassica napus NAC transcription factor 100 (NAC100.1) mRNA, complete cds.

KC966746; SV 1; linear; mRNA; STD; PLN; 655 BP.
KC966746;
Brassica napus NAC transcription factor 104 (NAC104.1) mRNA, complete cds.

KC966747; SV 1; linear; mRNA; STD; PLN; 1056 BP.
KC966747;
Brassica napus NAC transcription factor 19 (NAC19.1) mRNA, complete cds.

KC966748; SV 1; linear; mRNA; STD; PLN; 933 BP.
KC966748;
Brassica napus NAC transcription factor 2 (NAC2.1) mRNA, complete cds.

KC966749; SV 1; linear; mRNA; STD; PLN; 1043 BP.
KC966749;
Brassica napus NAC transcription factor 22 (NAC22.1) mRNA, complete cds.

KC966750; SV 1; linear; mRNA; STD; PLN; 839 BP.
KC966750;
Brassica napus NAC transcription factor 29 (NAC29.1) mRNA, complete cds.

KC966751; SV 1; linear; mRNA; STD; PLN; 925 BP.
KC966751;
Brassica napus NAC transcription factor 32 (NAC32.1) mRNA, complete cds.

KC966752; SV 1; linear; mRNA; STD; PLN; 1383 BP.
KC966752;
Brassica napus NAC transcription factor 50 (NAC50.1) mRNA, complete cds.

KC966753; SV 1; linear; mRNA; STD; PLN; 1283 BP.
KC966753;
Brassica napus NAC transcription factor 51 (NAC51.1) mRNA, complete cds.

KC966754; SV 1; linear; mRNA; STD; PLN; 938 BP.
KC966754;
Brassica napus NAC transcription factor 54-1 (NAC54-1.1) mRNA, complete cds.

KC966755; SV 1; linear; mRNA; STD; PLN; 944 BP.
KC966755;
Brassica napus NAC transcription factor 54-2 (NAC54-2.1) mRNA, complete cds.

KC966756; SV 1; linear; mRNA; STD; PLN; 949 BP.
KC966756;
Brassica napus NAC transcription factor 72 (NAC72.1) mRNA, complete cds.

KC966757; SV 1; linear; mRNA; STD; PLN; 1029 BP.
KC966757;
Brassica napus NAC transcription factor 79 (NAC79.1) mRNA, complete cds.

KC966758; SV 1; linear; mRNA; STD; PLN; 1794 BP.
KC966758;
Brassica napus NAC transcription factor 82 (NAC82.1) mRNA, complete cds.

KC966759; SV 1; linear; mRNA; STD; PLN; 965 BP.
KC966759;
Brassica napus NAC transcription factor 83 (NAC83.1) mRNA, complete cds.

KC966760; SV 1; linear; mRNA; STD; PLN; 810 BP.
KC966760;
Brassica napus NAC transcription factor 84 (NAC84.1) mRNA, complete cds.

KF738267; SV 1; linear; mRNA; STD; PLN; 930 BP.
KF738267;
Brassica napus NAC transcription factor 10-1 (NAC10-1.1) mRNA, complete cds.

KF738268; SV 1; linear; mRNA; STD; PLN; 931 BP.
KF738268;
UNVERIFIED: Brassica napus NAC transcription factor 10-2-like (NAC10-2.1) mRNA, complete sequence.

KF738269; SV 1; linear; mRNA; STD; PLN; 1908 BP.
KF738269;
Brassica napus NAC transcription factor 14 (NAC14.1) mRNA, complete cds.

KF738270; SV 1; linear; mRNA; STD; PLN; 858 BP.
KF738270;
Brassica napus NAC transcription factor 36 (NAC36.1) mRNA, complete cds.

KF738271; SV 1; linear; mRNA; STD; PLN; 738 BP.
KF738271;
Brassica napus NAC transcription factor 57 (NAC57.1) mRNA, complete cds.

KF738272; SV 1; linear; mRNA; STD; PLN; 966 BP.
KF738272;
Brassica napus NAC transcription factor 59 (NAC59.1) mRNA, complete cds.

KF738273; SV 1; linear; mRNA; STD; PLN; 1156 BP.
KF738273;
Brassica napus NAC transcription factor 74-1 (NAC74-1.1) mRNA, complete cds.

KF738274; SV 1; linear; mRNA; STD; PLN; 1178 BP.
KF738274;
Brassica napus NAC transcription factor 74-2 (NAC74-2.1) mRNA, complete cds.

KF738275; SV 1; linear; mRNA; STD; PLN; 837 BP.
KF738275;
Brassica napus NAC transcription factor 81 (NAC81.1) mRNA, complete cds.

KF738276; SV 1; linear; mRNA; STD; PLN; 870 BP.
KF738276;
Brassica napus NAC transcription factor 92 (NAC92.1) mRNA, complete cds.

KF738277; SV 1; linear; mRNA; STD; PLN; 1041 BP.
KF738277;
Brassica napus NAC transcription factor 103 (NAC103.1) mRNA, complete cds.

KF738278; SV 1; linear; mRNA; STD; PLN; 882 BP.
KF738278;
Brassica napus NAC transcription factor 105 (NAC105.1) mRNA, complete cds.

KF738279; SV 1; linear; mRNA; STD; PLN; 753 BP.
KF738279;
Brassica napus MYB transcription factor 13 (MYB13.1) mRNA, complete cds.

KF738280; SV 1; linear; mRNA; STD; PLN; 846 BP.
KF738280;
Brassica napus MYB transcription factor 15 (MYB15.1) mRNA, complete cds.

KF738281; SV 1; linear; mRNA; STD; PLN; 816 BP.
KF738281;
Brassica napus MYB transcription factor 32-1 (MYB32-1.1) mRNA, complete cds.

KF738282; SV 1; linear; mRNA; STD; PLN; 816 BP.
KF738282;
Brassica napus MYB transcription factor 32-2 (MYB32-2.1) mRNA, complete cds.

KF738283; SV 1; linear; mRNA; STD; PLN; 843 BP.
KF738283;
Brassica napus MYB transcription factor 46 (MYB46.1) mRNA, complete cds.

KF738284; SV 1; linear; mRNA; STD; PLN; 732 BP.
KF738284;
Brassica napus MYB transcription factor 90 (MYB90.1) mRNA, complete cds.

KF738285; SV 1; linear; mRNA; STD; PLN; 828 BP.
KF738285;
Brassica napus MYB transcription factor 95 (MYB95.1) mRNA, complete cds.

KF738286; SV 1; linear; mRNA; STD; PLN; 921 BP.
KF738286;
Brassica napus MYB transcription factor 108-1 (MYB108-1.1) mRNA, complete cds.

KF738287; SV 1; linear; mRNA; STD; PLN; 915 BP.
KF738287;
Brassica napus MYB transcription factor 108-2 (MYB108-2.1) mRNA, complete cds.

KF738288; SV 1; linear; mRNA; STD; PLN; 1032 BP.
KF738288;
Brassica napus MYB transcription factor 111 (MYB111.1) mRNA, complete cds.


01/01/2015

KJ420439; SV 1; linear; mRNA; STD; PLN; 1333 BP.
KJ420439;
Brassica napus NAC transcription factor 69-1 (NAC69-1.1) mRNA, complete cds.

KJ420440; SV 1; linear; mRNA; STD; PLN; 1338 BP.
KJ420440;
Brassica napus NAC transcription factor 91-1 (NAC91-1.1) mRNA, complete cds.

KJ420441; SV 1; linear; mRNA; STD; PLN; 1371 BP.
KJ420441;
Brassica napus NAC transcription factor 91-2 (NAC91-2.1) mRNA, complete cds.


[2014]